KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A1046Help
Entry
BURPS1710b_A1046  CDS       T00289                                 

Gene name
adhA
Definition
zinc-containing alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bpm00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BURPS1710b_A1046 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BURPS1710b_A1046 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    BURPS1710b_A1046 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    BURPS1710b_A1046 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BURPS1710b_A1046 (adhA)
   00626 Naphthalene degradation
    BURPS1710b_A1046 (adhA)
Enzymes [BR:bpm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BURPS1710b_A1046 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(1313697..1314722)
Genome map
AA seq 341 aa AA seqDB search
MAQYMKAAVVHAFGEPLRIEEVPVPTPGAGQILVNVKASGVCHTDLHAADGDWPVKPTLP
FIPGHEGVGFVAAVGEGVRHVKEGDRVGVPWLYTACGHCEYCQTGWETLCHEQQNTGYSV
NGSYAEYVLADPNYVGHLPSNVAFDEIAPILCAGVTVYKGIRVTDTRPGQWIAISGIGGL
GHVAVQYAKAMGLHVVAVDVAPQKLELARKLGAAFVVDASKDDPAAVIQKEIGGVHGVLV
TAVSRGAFAQALGMVRRGGTVSLNGLPPGDFPLPIFSTVLNGITVRGSIVGTRRDLQESL
DFAAEGLVRAHIHRDKLEHINGVFSALREGKVDGRIVLTGQ
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaatacatgaaggccgcggtggtgcatgcattcggcgaaccgcttcggatcgag
gaggtgcccgtgccgacgcccggcgcggggcagattctcgtgaacgtcaaggcatcgggc
gtgtgccataccgatctgcacgcggccgacggcgactggcccgtcaagccgacgctgccg
ttcattccggggcacgagggcgtcggcttcgtcgcggcggtgggcgaaggcgtgaggcac
gtgaaggagggcgatcgcgtcggcgtgccttggctctataccgcgtgcggccattgcgag
tattgccagaccggctgggagacgctgtgccacgagcagcagaacaccggctattcggtg
aacggcagctacgcggaatacgtgctcgccgatccgaactacgtcggccatctgccgagc
aacgtcgcgttcgacgagatcgcgccgatcctgtgcgcgggcgtgaccgtctacaagggc
attcgggtgaccgacacgcgcccggggcaatggatcgcgatctcggggatcggcgggctc
gggcacgtcgcggtgcagtacgcgaaggcgatggggctgcacgtggtcgcggtggacgtc
gcgccgcagaagctcgagcttgcgcgcaagctgggtgcggcgttcgtcgtcgatgcgtcg
aaggacgatccggcggcggtgatccagaaggagatcggcggcgtgcacggcgtgctcgtg
acggccgtgtcgcgcggcgcgttcgcgcaggcgctcggcatggtgaggcgcggcgggacg
gtctcgctgaacgggctgccgccgggcgattttccgctgccgatcttctcgacggtgctc
aacgggatcacggtgcgaggctcgatcgtcggcacgcggcgcgatctccaggaatcgctc
gatttcgcggccgaagggctcgtgcgcgcgcatatccatcgcgacaagctcgagcacatc
aacggcgtgttctcggcgctgcgtgaagggaaggtcgacgggcggatcgtgttgaccggg
caatga

DBGET integrated database retrieval system