KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A1061Help
Entry
BURPS1710b_A1061  CDS       T00289                                 

Gene name
pfk
Definition
6-phosphofructokinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bpm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BURPS1710b_A1061 (pfk)
   01230 Biosynthesis of amino acids
    BURPS1710b_A1061 (pfk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BURPS1710b_A1061 (pfk)
   00030 Pentose phosphate pathway
    BURPS1710b_A1061 (pfk)
   00051 Fructose and mannose metabolism
    BURPS1710b_A1061 (pfk)
   00052 Galactose metabolism
    BURPS1710b_A1061 (pfk)
  Energy metabolism
   00680 Methane metabolism
    BURPS1710b_A1061 (pfk)
Enzymes [BR:bpm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BURPS1710b_A1061 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(1327779..1329200)
Genome map
AA seq 473 aa AA seqDB search
MCAALARRARCSILAASGKRQAASGKRQAASGKRQAASGKRQAASGKRQAASGKRQAASG
KRQAASGKRQAASGKRQAASGKRQAASGKQQAASSKQQAASSKQQAASSSRSSPGLMVRR
RIERKHCGACPPRSTREPRTRASRCVVFPSRIPTLKPNVTMPEIVTLTPNPAIDVATCVE
RVTDTRKLRCGPARRDPGGGGINVARVLTRLGADCSAVYLAGGGTGLALRGLLADEGVRA
HGIDIAGETRENFSVLETSTGREFRFVLPGPALAAHEWPRCVEALGRLADASRYLVMSGS
LPPGMPDDCYARLARRASARGVRTVVDTSGPALAAALDAGVYLVKPSLGELRALTGLPLE
DDGARLAAARAIVAGGRVQIVALTLGDAGALVVSRDDAVRLPGVKVAVRSAIGAGDSFVA
GLVAALNRGANVADAARHALAAASASLLSTGTALGTKEDIARIYRELPGTIDA
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgcggcgcttgcgcgtcgcgcgcgatgttcgatactggcggcaagcggcaagcgg
caagcggcaagcggcaagcggcaagcggcaagcggcaagcggcaagcggcaagcggcaag
cggcaagcggcaagcggcaagcggcaagcggcaagcggcaagcggcaagcggcaagcggc
aagcggcaagcggcaagcggcaagcggcaagcggcaagcggcaagcggcaagcggcaagc
ggcaagcggcaagcggcaagcggcaagcagcaagcagcaagcagcaagcagcaagcagca
agcagcaagcagcaagcagcaagcagcagtcgatcgtcgccggggctgatggttcgacgc
cgaatcgaacgcaagcattgcggcgcgtgcccgccgcgcagcacccgcgagccgcgcacc
cgagccagccgctgcgttgtctttccgtcgcgaattcccacgttgaaaccgaacgtcacg
atgcccgaaatcgtcaccctcacgccgaatcccgccatcgacgtcgcgacgtgcgtcgag
cgagtcaccgacacccgcaagctgcgctgcggccccgcacgacgcgatccgggcggcggc
ggaatcaatgtcgcccgcgtgctgacgcgcctcggcgccgattgttcggccgtctacctg
gcgggcggcggcaccggcctcgcgctgcgcggcctgctcgccgacgaaggcgtgcgggcg
catggcatcgacatcgccggcgagacgcgcgaaaacttttcggtgctcgaaacgtcgacg
ggccgcgaattccgcttcgtgttgcccgggccggcgctcgcggcgcacgaatggccgcgc
tgcgtcgaagcgctcgggcggctcgccgacgcgtcgcgctatctggtgatgagcggcagc
ctgccgcccggcatgccggacgattgctacgcccggctcgcgcggcgcgcgagcgcgcgc
ggcgtgcgcacggtcgtcgatacgtcggggccggcgctcgccgccgcgctcgatgcgggc
gtctatctggtgaagccgagcctcggtgagttgcgcgcgctgaccggcctgccgctcgaa
gacgacggcgcgcgccttgccgccgcgcgcgcgatcgtcgccggcgggcgcgtgcagatc
gtcgcgctgacgctcggcgacgcgggcgcgctcgtcgtgtcgcgcgacgatgcggtgcgt
ctgccgggcgtgaaggtggcggtgcgcagcgcgatcggcgcgggcgacagcttcgtcgcg
gggctcgtcgccgcgctcaatcgcggcgcgaacgtcgccgacgcggcgcgccatgcgctc
gccgccgcgtcggcgtcgctgctgagcacgggcaccgcgctgggcacgaaggaagacatc
gcgcggatctatcgcgaactgccggggacgatcgacgcgtga

DBGET integrated database retrieval system