KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A1066Help
Entry
BURPS1710b_A1066  CDS       T00289                                 

Gene name
deoA
Definition
(GenBank) thymidine phosphorylase (EC:2.4.2.4)
  KO
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpm00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BURPS1710b_A1066 (deoA)
Enzymes [BR:bpm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     BURPS1710b_A1066 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
II:complement(1331141..1332514)
Genome map
AA seq 457 aa AA seqDB search
MHFECNCAVENQPLMQTMTFLPQEFIRKVRDRAPLDTADVARFVQGVTAGDVTEGQIAAF
AMAVYFNELPLSARIALTLAQRDSGDVLDWRGARLNGPVVDKHSTGGVGDLTSLVIGPMV
AACGGYVPMISGRGLGHTGGTLDKLEAIPGYDVAPSVDMLRRVVRDAGLAIVGQTAQLAP
ADKRIYAVRDVTATVESISLITASILSKKLAAGVGALAMDVKVGSGAFMPSAEQSAELAR
SIVDVGNGAGMRTAATLTDMNQALAPCAGNAIEVRCAIDFLTGAARPARLEAVSFALAAQ
MLTMGGLAADAHDARRRLRAVLESGAAAERFARMVAALGGPADLVERPERHLPRAAAAAP
VAAARAGWIERIDARALGLAVVGLGGGRAKIGDTLDYSVGLSALAELGERVEAGQPLATV
HARDADSAAQATDAVRRAYRIGAEPPAQTRVVHAVIE
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgcatttcgaatgcaattgcgccgttgaaaatcaaccgcttatgcaaaccatgaccttc
ctgccgcaggaattcatccgcaaggtgcgcgaccgcgcgccgctcgacacggccgacgtc
gcgcgtttcgtccaaggcgtgacggcgggcgacgtgaccgaaggccagatcgccgcgttc
gcgatggcggtctatttcaacgagttgccgctgtccgcgcgcatcgcgctgacgctcgcg
cagcgcgattccggcgacgtgctcgactggcgcggcgcgcgcctgaacgggccggtggtc
gacaagcactcgacgggcggcgtcggcgatctgacctcgctcgtgatcgggccgatggtg
gccgcgtgcggcggctacgtgccgatgatctcgggccgcggcctcggccacacgggcggc
acgctcgacaagctcgaggcgattcccggttacgatgtcgcgccgtccgtcgacatgctg
cgccgcgtcgtgcgcgacgcgggccttgcgatcgtcggccagaccgcgcagctcgcgccc
gccgacaagcggatctatgcggtgcgcgacgtgacggcgaccgtcgaatcgatctcgctg
atcaccgcgtcgatcctgtcgaagaagctcgcggcgggcgtcggcgcgctcgcgatggac
gtgaaggtcggctccggcgcgttcatgccgagcgcggagcaatcggccgaactcgcgcgc
agcatcgtcgacgtcggcaacggcgcggggatgaggacggccgcgacgctcaccgacatg
aaccaggcgctcgcgccatgcgcgggcaacgcgatcgaggtgcgctgcgcgatcgatttc
ctgacgggcgcggcgcgccccgcgcggctcgaagcggtcagcttcgcgctcgccgcgcag
atgctgacgatgggcgggcttgccgcggacgcgcacgatgcgcgccgccggttgcgcgcg
gtgctcgaatcgggcgcggccgcggagcggttcgcgcggatggtcgcggcgctcggcggg
cccgccgatctggtcgagcggcccgagcggcatctgccgcgcgcggctgccgccgccccc
gtggccgccgcgcgcgccggctggatcgagcggatcgacgcgcgcgcgctcggcctggcg
gtcgtcggcctgggcggcgggcgcgcgaagatcggcgacacgctcgattactcggtcgga
ctgtccgcgctcgcggagctgggcgagcgcgtcgaggcgggccagccgctcgcgaccgtt
cacgcgcgcgacgccgattcggccgcgcaggcgaccgacgcggtgcggcgcgcctaccgg
atcggcgcggagccgccggcgcagacgcgcgtcgttcatgccgtgatcgaatga

DBGET integrated database retrieval system