KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A1237Help
Entry
BURPS1710b_A1237  CDS       T00289                                 

Definition
acetyltransferase
Orthology
K01905  
acetyl-CoA synthetase (ADP-forming) [EC:6.2.1.13]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bpm00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bpm00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bpm00640]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(1547312..1550386)
Genome map
AA seq 1024 aa AA seqDB search
MNSNLVSDGPRRSLDCTAIFCPARRLPAIGQCIEFAGPPFSIPEPAGPMFRDGRFSTDES
GFECRAAGRGDPRDGTSTRGFLPLADVAVEPGAPCSRVHAAAERRGETRCRASRDGRPES
HRAPVSTPSSRARHAAGRKTGLAACGPPACSLHPFISCRSVSKEKARAVQCMRPRSGWFG
GGGEVCASMMRALAWFGDSAERHIGGARCFAYPMGTRARSGVAARRSPSLNPFSGVAVTV
RNLDALFHPTAVAVVGASPRPGSVGAMVWACVLDGRFGGAIWPVNPKYGELNGHKVYPYV
DQLPSAPSVALICTPPATWPGIVRKLGGLGVRAAIIVGETRSGADRAALERALAAAKPYL
LRVVGPGSLGVVSPALGAHFGAPACIVKAGGVAWVSQSNALTNAVLGWAHARGLGFSHAV
ALGGEADVDAADVLDYLASDAETRAILLELDTVKSARKFMSAARAAARNKPVLALRAGRG
DSGDLLYTAAFQRAGMVRVDALDDLLDEIEALGVGRAAATSGGVTLVTSDRGVAKLAVDA
LAAAGETLAQWPRAAVDEVGGALPAGIVAGNPLLLGDDARPEYFGAALKALAQHPPTGTV
FVVHATSHSAPAVDVARVLIESRKFARRGMLACFFGGVDAATRDALHVHGIPVHTTPQRL
ARAHARLVDYQLGRELLMQTPEGTPPQPAASISAARHTARAALAQGRDGFEGDAALEWLA
GFGIERATDADVDMGDTIVDITVGMYDDPNFGPVFRYSVPPADGVSAPFVVYGLPPFNTV
LARAVVARSPYAHRAPPEPLLQALTALSQAVCDVREIVEMSLVLRVRPTRVVALGPHIRL
ATGRSRLAIVPYPRYLEQQLDWRGERITVRPIRPEDEAAHRELLSAMTPDDLRMRFFGAI
RNFDHSQIARMTQIDYDREMALIATLDDADGRAHTLGAVRAVTDPDNEATEFAIAVRPDQ
KGKGLGRMLMTRIIDYARSRGTAWMIGEALRENTAMISLAKDSGFAVSSTEEPGVVAFRL
KLQP
NT seq 3075 nt NT seq  +upstreamnt  +downstreamnt
ttgaattcgaatctggtcagtgatgggccacgtcgttcgcttgattgcacggcgattttt
tgccctgcgcggcgattgcccgctattgggcaatgcatcgaatttgccggtccgccattt
tcgattcccgagccggccggaccgatgtttcgagacggccgtttcagcaccgacgagtcg
ggcttcgaatgtcgtgcagcgggtcgtggcgatccgcgggacgggacctcgacgcgcggg
tttcttccgctggcggacgttgcagtcgagcccggggcgccgtgttcgcgcgtgcatgca
gcggcggagcgccgcggcgagacgcgttgccgcgcgagtcgtgacggcaggccagaatcg
catcgcgcgcccgtatcgacgccgtcgagccgcgcgcggcatgccgccgggcgcaagaca
gggctcgccgcatgcgggcccccggcttgttcgctccatccgttcatttcgtgtcgctcc
gtttcgaaagagaaggctcgcgccgttcaatgcatgcggccgcgaagcggctggttcggc
ggcggcggcgaagtgtgtgcgtcgatgatgcgggcgcttgcgtggttcggcgattcggcc
gaacggcatataggcggcgctcgatgcttcgcctatcctatgggcactcgggcgcggtcc
ggcgtggccgcgcgtcgatcgccgtcgctcaatcctttcagcggagttgccgtgaccgtt
cgcaatctcgatgcgttgttccatccgacagccgttgccgtcgtcggcgcttcgccgcgc
ccgggcagcgtcggcgcgatggtgtgggcgtgcgtgctcgacggccggttcggcggcgcg
atctggcctgtcaacccgaagtacggcgaactgaacggccacaaggtttatccctatgtc
gaccagctgccgagcgcgccgtcggtcgcgctcatatgcacgccgcccgcgacgtggccc
ggcatcgtgcgcaagctgggcggcctgggcgtgcgtgcggcgatcatcgtcggcgagact
cgttcgggcgcagaccgggccgcgctggaacgggcgcttgccgcggcgaagccatatctg
ctgcgcgtcgtcgggccgggcagcctgggcgtggtgtcgcccgcgctgggcgcgcatttc
ggcgcgccggcgtgcatcgtcaaggcgggtggcgtcgcatgggtgtcgcaatcgaatgcg
ctgacgaacgcggtgctcggctgggcgcatgcgcgcgggctcggtttctcgcatgcggtc
gcactcggcggcgaggcggatgtcgacgcggccgacgtgctcgactacctggcgagcgat
gccgagacacgcgcgatcctgctcgagctcgacacggtgaaatcggcgcgcaagttcatg
tcggcggcgcgcgccgcggcgcgcaacaagccggtgcttgcgttgcgcgcggggcgcggc
gattcgggcgacctgctttacacggccgcgtttcagcgcgcggggatggtgcgcgtcgac
gcgctcgacgatcttctcgacgagatcgaggcgctcggcgtcggccgtgccgcggcgacg
agcggcggggtgacgctcgtcacgagcgacaggggcgtcgcgaagcttgccgtcgacgca
ctcgcggcggcgggggaaacgctggcgcaatggccgcgggcggccgtcgacgaagtcggc
ggcgcgctgcccgcaggcatcgtcgccggcaatccgttgctgctcggcgacgacgcgcgg
cccgaatatttcggcgcggcgctgaaggcgctcgcgcagcatccgccgacaggcaccgtg
ttcgtggttcatgcgacgtcgcatagcgcgcctgccgtcgacgtcgcacgtgtgctgatc
gaatcgcgcaagttcgcgcgtcgcggcatgctcgcgtgcttcttcggcggcgtcgacgcc
gcgacgcgcgacgcgctgcacgtgcacggcatccccgtgcacacgacgccgcagcgtctc
gcgcgcgcgcatgcgcgccttgtcgattatcaattgggccgggagctgttgatgcagacg
ccggagggcacgccgccgcaaccggcggcgtcgatctcggccgcgcggcacacggcgcgc
gcggcgctcgcgcaggggcgcgacgggttcgaaggcgacgcggcgctcgaatggctggcg
ggtttcggcatcgagcgcgcgaccgacgcggacgtcgacatgggcgatacgatcgtcgac
atcacggtcgggatgtacgacgacccgaacttcgggccggtattccgctattcggtgccg
ccggcggatggcgtgtccgcgccgttcgtcgtctacgggctgccgcctttcaataccgtg
ctcgcgcgcgcggtcgtcgcgcgatcgccgtatgcgcatcgcgcgccgcccgagccgctt
ctgcaggcactgaccgcgctttcgcaggcggtgtgcgatgtgcgcgaaatcgtcgagatg
tcgcttgtgctgcgcgtgcggcccacacgcgtggtcgcgcttgggccgcacatcaggctc
gcgacggggcgcagccggctcgcgatcgtgccatatccgcgctatctcgagcagcagctc
gactggcgcggagaacgcatcacggtgcgtccgattcgccccgaggacgaggccgcgcat
cgcgagctgctgagcgcgatgacgccggacgatctgcgaatgcgcttcttcggtgcgata
cgcaacttcgaccattcgcagatcgcgcggatgacgcagatcgattacgaccgcgagatg
gcgctgatcgcgacgctcgacgatgccgacggccgcgcgcatacgctcggcgcggtgcgc
gcggtgaccgatccggacaacgaagcgacggagttcgcgatcgcggtgcggcctgaccaa
aagggcaaggggctcggacggatgttgatgacgcgcatcatcgactacgcgcgctcgcgc
ggaacggcgtggatgatcggcgaggcactgcgcgagaacacggcgatgatctcgctcgcg
aaggacagcggttttgcggtgtcgtcgaccgaggagcctggggtggtggcgttccggctg
aagctgcagccgtga

DBGET integrated database retrieval system