KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A1280Help
Entry
BURPS1710b_A1280  CDS       T00289                                 

Gene name
hpnA
Definition
dihydroflavonol-4-reductase family protein
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
bpm  Burkholderia pseudomallei 1710b
Brite
Enzymes [BR:bpm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     BURPS1710b_A1280 (hpnA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:1592432..1593448
Genome map
AA seq 338 aa AA seqDB search
MRTMTDTQRDLVLVTGASGFVGSAVARAARRQGYRVRVLVRPTSPRTNVADLDAEIATGD
MRDEASMRAALRGVRHLLHVAADYRLWAPDPLEIERANLEGAVATMRAALAEGVERIVYT
SSVATLKVTPSGASADESSPLAAGQAIGVYKRSKVLAERAVERMIAEDGLPAVIVNPSTP
IGPRDVKPTPTGRIIVEAALGKIPAFVDTGLNLVHVDDVAQGHLLALERGRVGERYILGG
ENLPLQAMLADIAQSTGRKPPTIALPRWPLYPIALGAEAVAKLTKREPFVTVDGLRMSKN
KMYFTSAKAERELGYRARPYREGIRDALDWFRQAGYLR
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaggaccatgactgacacacaacgcgatctcgttctggtgaccggcgcatccggtttt
gtcggctccgccgtcgcgcgcgccgcgcggcggcagggctatcgggtgcgcgtgctcgtg
cggccgacgagcccgcgcacgaacgtcgcggatctcgacgccgagatcgccaccggcgac
atgcgcgacgaggcatcgatgcgcgccgcgctgcgcggcgtgcgccatctgctgcacgtc
gccgccgactaccggctgtgggcgcccgatccgctcgagatcgagcgcgcgaatctcgaa
ggcgcggtcgcgacgatgcgcgcggcgctcgccgagggcgtcgagcggatcgtctacacg
agcagcgtcgccacgctgaaggtaacgccgtcgggcgcctcggccgacgaatcgtcgccg
ctcgccgccgggcaggcgatcggcgtatacaagcgcagcaaggtgctcgccgagcgcgcg
gtcgagcggatgatcgccgaggacgggctgcccgcggtgatcgtcaatccgtcgacgccg
atcggcccgcgcgacgtgaagccgacgccgaccggccggatcatcgtcgaggcggcgctc
ggcaagatcccggcgttcgtcgacacggggctgaacctcgtgcacgtcgacgacgtcgcg
cagggccacctgctcgcgctcgagcgcgggcgcgtcggcgagcgctacatcctcggcggc
gagaacctgccgctgcaggcgatgctcgccgacatcgcgcaatcgacgggacgcaagccg
ccgacgatcgcgctgccgcgctggccgctgtatccgatcgcgctcggcgcggaggcggtg
gcgaagctgacgaagcgcgagccgttcgtgacggtcgacgggctcaggatgtcgaagaac
aagatgtatttcacgtccgcgaaagccgagcgcgagctcggctaccgcgcgcggccgtac
cgcgaaggcattcgcgacgcgctcgactggttcaggcaggcgggctatctgcgctga

DBGET integrated database retrieval system