KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A1524Help
Entry
BURPS1710b_A1524  CDS       T00289                                 

Gene name
bdhA-1
Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpm00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BURPS1710b_A1524 (bdhA-1)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    BURPS1710b_A1524 (bdhA-1)
Enzymes [BR:bpm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     BURPS1710b_A1524 (bdhA-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(1855300..1856085)
Genome map
AA seq 261 aa AA seqDB search
MSNLNGKTAIVTGAASGIGKEIALELARAGAAVAIADLNQDGANAVAELIEQAGGRAIGV
AMDVTNEDAVNAGIDKVAQTFGSVDILVSNAGIQIVNPIENYAFADWKKMQAIHVDGAFL
TTKAALKHMYKDDRGGVVIYMGSVHSHEASPLKSAYVTAKHGLLGLARVLAKEGAKHNVR
SHVVCPGFVRTPLVDKQIPEQAKELGISEEEVVKKVMLGQTVDGVFTTVEDVAKTVLFLS
AFPSAALTGQSFVVSHGWFMQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatctgaatggcaaaaccgccatcgtgacgggcgcggcgagcggcatcggcaag
gaaatcgcgctggagctcgcgcgcgcgggcgcggcggtggcgatcgccgatctgaaccag
gacggcgcgaacgcggtggccgagctcatcgagcaggcgggcggccgggcgatcggcgtg
gcgatggacgtgacgaacgaggacgcggtgaacgccggcatcgacaaggtcgcccagacg
ttcggctcggtcgacattctcgtgtcgaacgcgggcatccagatcgtcaatccgatcgag
aactatgcgttcgccgactggaagaagatgcaggcgattcacgtcgacggcgcgttcctg
acgacgaaggccgcgctcaagcacatgtacaaggacgatcgcggcggagtggtgatctac
atgggctcggtgcattcgcacgaggcgtcgccgctgaagtcggcgtacgtgacggccaag
cacgggctgctggggcttgcgcgcgtgctggcgaaggaaggcgcgaagcacaacgtgcgc
tcgcatgtggtgtgcccgggcttcgtgcgcacgccgctcgtcgacaagcagattccggag
caggccaaggagctcggcatcagcgaagaggaggtggtgaagaaggtgatgctcggccag
acggtggacggcgtgttcacgacggtcgaggacgtcgcgaagacggtgctgttcctgtcc
gcgttcccgagcgcggcgctcaccggccagtcgttcgtcgtcagccacggctggttcatg
caatga

DBGET integrated database retrieval system