KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A1658Help
Entry
BURPS1710b_A1658  CDS       T00289                                 

Definition
putative amylase
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BURPS1710b_A1658
Enzymes [BR:bpm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     BURPS1710b_A1658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(2025166..2027811)
Genome map
AA seq 881 aa AA seqDB search
MSARHFGFKQAVLVGSLAALAGAAALPANTSAAEAFGSPGAAPVRGPAAKSFLGTAVNGA
SRVYFTGYRGILSEVYYPVLDTPESVDLQFLVGDAGKTFVDEEKQQAYSAAQTDTRTMSW
QVTTGNSSHNWQIRKIVFADPNHNAIVQRVTFTALNGRKVGDFNLYMLSKPYLDNAGANN
TAQTVSGSGGTALVANHNSRYSALVASRPWKVVNGVGMTSNGFVGQSDGWTDLLGGTADK
TMDWTFSSATNGNVAQMGWLDLGDPSATSVSFDVVLGFGGTQDQALGDANTVLGSDLAGE
QQQYDTGWHNYAAGLSSQNGAADDGYYLAAMTLKTMQDKSNGAMIAGIGTPWGETQGDAN
AGGYHLVWPRDLFKFANALTTAGDTSSATSVVNYLFNTLQQTTDCGTAEYNAPGCAQGYS
RVGRFPQNAWVNGWPYWQGTQMDEQAMPIILAWRLGPSVFNPLWPKIKLTADYIVNTGPW
TYQERWEENAGYSPSTIAAEIAGLVTAADIATQNGDTASAARYLAAADYWQENVAAWTYT
SSGAFGNGSYYIRINPAGRAGTGTDRASFAPTAGPDTPQTLSVKNGGGSHDARRVVDGGF
FELVRMGVKRATDPTIANTISVYDSVLGQTLNVANAPALSPNAWFRYNFDGYGEHNDGGD
FDGTGAGRLWPIFTAERGMVEIARQGSGGAGSAYFSTLKQLTTPEGFVPEQVWSNSTTLP
DGWAVTTPAGYTPGQPTKSMAPLNWAMGEYISLLASIQAGRIVDVPSVVCARYNNCAAPP
QSGQVPVAVNVNASTQLGQQMYVTGNVAALGNWNTDLGIPVDPASYPVWRNTVNLPAAQA
IQYKYYRKNADGSVTWENRSGNRQLQTPASGTLALNDQVSW
NT seq 2646 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcaaggcacttcggattcaagcaggcggtgctggtgggcagtctggccgcgctc
gcgggcgcggcggccctaccggcgaatacttcggctgccgaagcattcggctcgcccggc
gccgcgcccgtgcggggcccggcggccaagtcgttcctcggcacggcggtcaacggcgca
tcgcgggtgtacttcaccggttatcgcggcatcctgtccgaggtctactacccggtcctc
gatacgcccgagtccgtcgacctgcagttcctcgtcggcgacgccggcaagaccttcgtc
gacgaagaaaagcagcaggcctactcggccgcgcaaacggacacgcgcacgatgagctgg
caggtgacgaccggcaacagttcgcacaactggcaaattcgcaagatcgtcttcgccgat
ccgaaccacaacgcgatcgtgcagcgcgtcacgttcaccgcgctcaacggccgcaaggtg
ggcgacttcaatctctacatgctgtccaagccgtacctcgacaacgccggcgccaacaat
accgcgcaaacggtgtccggcagcggcggcaccgcgctcgtcgcgaatcacaacagccgc
tattcggcgctcgtcgcgagccgcccgtggaaggtggtcaacggcgtgggcatgacgtcg
aacggcttcgtcgggcagagcgacggctggaccgacctgctcggcggcaccgccgacaag
acgatggactggaccttctcgtccgcgaccaacggcaacgtcgcgcagatgggctggctc
gacctcggcgatccgagcgcgacgagcgtgtcgttcgacgtcgtgctcggcttcggcggc
acgcaggaccaggcgctcggcgacgcgaacacggtgctcggcagcgatctcgccggcgag
cagcagcagtacgacaccgggtggcataactatgcggcgggcctgtcgtcgcagaacggc
gccgcggacgacggctactacctggccgcgatgacgctcaagacgatgcaggacaagagc
aacggcgcgatgatcgccggcatcggcacgccgtggggcgaaacgcagggcgatgcgaac
gcgggcggctatcacctcgtgtggccgcgcgacctgttcaagttcgcgaacgcgctgacg
acggcgggcgacacgtcgagcgcgacgagcgtcgtcaactacctgttcaacacgctgcag
cagacaaccgattgcggcaccgccgaatacaacgcgcccggctgcgcgcagggctacagc
cgcgtcgggcgctttccgcagaacgcatgggtgaacggctggccgtactggcagggcacg
cagatggacgagcaggcgatgccgatcatcctcgcgtggcgcctcggcccgagcgtgttc
aatccgctgtggccgaagatcaagctcaccgccgactacatcgtcaataccggcccctgg
acgtaccaggagcgctgggaggagaacgccggctattcgccgtcgacgatcgccgccgag
atcgcgggcctcgtcacggcggccgatatcgcgacgcaaaacggcgacacggcgagcgcc
gcgcgctacctcgccgcggccgactactggcaggagaacgtcgcggcgtggacgtacacg
tcgagcggcgcgttcggcaacggcagctactacatccggatcaatccggcgggccgcgcg
ggcaccggcaccgaccgcgcgagcttcgcgccgaccgccggccccgacacgccgcagacg
ctgagcgtgaagaacggcggcggcagccacgacgcgcggcgcgtcgtcgacggcggcttc
ttcgagctcgtccggatgggggtcaagcgcgcgaccgatccgacgatcgccaacacgatc
tcggtctacgacagcgtgctcggccagacgctgaacgtcgcgaacgcgccggcgctgtcg
ccgaacgcgtggttccgctacaacttcgacggctacggcgagcacaacgacggcggcgat
ttcgacggcaccggcgccggccggctgtggccgatcttcaccgccgagcgcggcatggtc
gagatcgcgcgccagggcagcggcggcgcgggcagcgcgtacttctcgacgctcaagcaa
ttgacgacgcccgagggcttcgtgccggagcaggtgtggtcgaattcgacgacgctgccc
gacggctgggcggtgacgacgcccgcgggctacacgccgggccagccgaccaaatcgatg
gcgccgctcaactgggcgatgggcgaatacatcagcctgctcgcgtcgatccaggcgggg
cgcatcgtcgacgtgccgtcggtggtctgcgcgcgctacaacaactgcgccgcgccgccg
caaagcgggcaggtgccggtggccgtcaacgtgaacgcgagcacgcagctcggccagcag
atgtacgtgacaggcaacgtcgccgcgctcggcaattggaacaccgatctcggcattccg
gtcgatccggccagctacccggtgtggcgcaacaccgtcaacctgccggccgctcaggcg
atccagtacaagtactaccggaagaacgcggacggcagcgtgacgtgggagaaccgttcc
ggcaaccgccagcttcagacgcccgcgagcggcacgttggcgctgaacgatcaggtgagc
tggtga

DBGET integrated database retrieval system