KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A1918Help
Entry
BURPS1710b_A1918  CDS       T00289                                 

Gene name
bdhA-2
Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bpm00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:bpm00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:2333070..2333858
Genome map
AA seq 262 aa AA seqDB search
MTSNLNGKAAIVTGAASGIGKEIALELARAGAAVAIADLNQDGANAVAELIEQAGGRAIG
VAMDVTNEDAVNAGIDKVAQTFGSVDILVSNAGIQIVNPIENYAFADWKKMQAIHVDGAF
LTTKAALKHMYKDDRGGVVIYMGSVHSHEASPLKSAYVTAKHGLLGLARVLAKEGAKHNV
RSHVVCPGFVRTPLVDKQIPEQAKELGISEEEVVKKVMLGQTVDGVFTTVEDVAKTVLFL
SAFPSAALTGQSFVVSHGWFMQ
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgacttcgaacttgaacgggaaggcggccatcgtgacgggcgcggcgagcggcatcggc
aaggaaatcgcgctggagctcgcgcgcgcgggcgcggcggtggcgatcgccgatctgaac
caggacggcgcgaacgcggtggccgagctcatcgagcaggcgggcggccgggcgatcggc
gtggcgatggacgtgacgaacgaggacgcggtgaacgccggcatcgacaaggtcgcccag
acgttcggctcggtcgacattctcgtgtcgaacgcgggcatccagatcgtcaatccgatc
gagaactatgcgttcgccgactggaagaagatgcaggcgattcacgtcgacggcgcgttc
ctgacgacgaaggccgcgctcaagcacatgtacaaggacgatcgcggcggagtggtgatc
tacatgggctcggtgcattcgcacgaggcgtcgccgctgaagtcggcgtacgtgacggcc
aagcacgggctgctggggcttgcgcgcgtgctggcgaaggaaggcgcgaagcacaacgtg
cgctcgcatgtggtgtgcccgggcttcgtgcgcacgccgctcgtcgacaagcagattccg
gagcaggccaaggagctcggcatcagcgaagaggaggtggtgaagaaggtgatgctcggc
cagacggtggacggcgtgttcacgacggtcgaggacgtcgcgaagacggtgctgttcctg
tccgcgttcccgagcgcggcgctcaccggccagtcgttcgtcgtcagccacggctggttc
atgcagtaa

DBGET integrated database retrieval system