KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A2291Help
Entry
BURPS1710b_A2291  CDS       T00289                                 

Definition
hydrolase alpha/beta fold domain-containing protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bpm  Burkholderia pseudomallei 1710b
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(2781579..2782400)
Genome map
AA seq 273 aa AA seqDB search
MTGRTGILLIHGLGGTQYDLGSLHKAMRRAGGDTHMITLPGHGTRPEDLVDVRAEAWLDA
VTAQYRALEREYDTVHVAGMCMGALVALLLCRRVRHARGRLALLAAPMFIDGWSTPWYRS
LRHLLYRVPGVPARLRVDEDEPFGIKNPTIRAIVKKKFERQDNFHYPWVPLACIRQVDRL
RSWARAAAADTHCPTLVLHAREDELTSLRSADFLLKHLPDARGIVLENSYHMICADNDRD
EVARQVLTFFGFDPSHAMSPAMARRMGRADPRA
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaccggccgaacgggcattctgctgatccacgggctcggcgggacgcagtacgatctc
ggctcgctgcacaaggcgatgcgccgggcgggcggcgacacgcacatgatcacgctgccg
gggcacggcacgcgccccgaggatctcgtcgacgtgcgcgcggaagcgtggctcgacgcg
gtcaccgcgcagtatcgcgcgctcgagcgcgagtacgacaccgtgcatgtcgcgggcatg
tgcatgggcgcgctcgtcgcgctgctgctgtgccggcgcgtgcggcacgcgcgcgggcgg
ctcgcgctgttggccgcgccgatgttcatcgacggctggtcgacgccctggtaccgatcg
ctgcgacatctgctgtaccgcgtgcccggcgtgccggcgcggctgcgcgtcgacgaggac
gagccgttcggcatcaagaacccgacgattcgcgcgatcgtgaagaagaagttcgagcgt
caggacaacttccactatccatgggtgccgcttgcatgcatccgccaggtcgatcgcctg
cgaagctgggcgcgcgcggcggcggccgacacgcactgcccgacgctcgtgctgcatgcg
cgcgaggacgagctcacgagcctgcgctcggcggacttcctgctgaagcacctgcccgac
gcgcgcgggatcgtgctggagaacagctaccacatgatctgcgcggacaacgatcgcgac
gaagtcgcccggcaggtgctgacgtttttcggcttcgatccgtcacatgcgatgagcccg
gcgatggcgcgccggatggggcgcgccgatccgcgagcgtga

DBGET integrated database retrieval system