KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A2342Help
Entry
BURPS1710b_A2342  CDS       T00289                                 

Definition
di-heme cytochrome c peroxidase family protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
bpm  Burkholderia pseudomallei 1710b
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(2848029..2849651)
Genome map
AA seq 540 aa AA seqDB search
MRRARSARRRPHATRARYITDARPAGARNAGRHSGATHAGFFFCMITTERSSMAEPLCAQ
PAPSTRSDACAPAALATVSRRRGRRNACAMRHAPAAAAFGALGFAAFALAFPEHVPNAVG
AIVENLTGANPQPVALRRPGAEPLSAVAQLGRALFFDPALSASGRQSCASCHSPDHAYGP
PNDLDVQLGGAALTQPGYRPPPSLMYLYRQPNFSIGPDSSENDDAASVAQQAASQAASAA
GAVRARKSAGAAAAPQLVPQGGMFWDGRADTLQQQAFGPLMNPVEMANASTGDVARKLAH
ARYAPRFRQLFGPRIFDDARLAVSEAMFAIARYQVEDPSFHPYSSKYDRWLEGDARLTQA
ELRGMRRFNDPNKANCAGCHLSKPSADGLPPMFTDFQYEALGVPRNRALAQNRNPAFHDL
GICGPFRDNLKTQTQYCAMFATPSLRNVATRRVFFHNGVYHSLDRVLAFYNLRSVDPGKI
YPRDASGRVLQYDDIPSAYRANVDVADAPFDRKPGDAPAMTEQDMRDIVAFLNTLTDEKR
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
gtgcgccgcgcacgctcggcgcggcgccgcccgcacgcgacgcgcgcccgatacatcacc
gatgcacggccggccggcgcacgcaacgccggccgtcattccggcgcgacgcacgccgga
tttttcttttgcatgatcacgaccgaacgctccagcatggccgaaccgctttgcgcgcaa
cccgctccgtccacccgatccgacgcatgcgcgccggccgcgcttgccaccgtctcgcgc
cgccgcggccgccgcaacgcgtgcgcgatgcgccacgcgccggcggccgccgcgttcggc
gcgctcggcttcgccgcgttcgcgctggcgtttcccgagcacgtgccgaacgcggtcggc
gcgatcgtcgaaaacctcacgggcgcgaatccgcagccggtcgcgctgcgccgcccgggc
gccgagccgctgagcgcggtcgcgcagctcggccgcgcgctgttcttcgatcccgcgctg
tccgcgtcgggccggcaatcgtgtgcgtcgtgccacagccccgatcatgcgtacggcccg
ccgaacgatctggacgtgcaactgggcggcgccgcgctgacgcagcccggctatcggccg
ccgccgtcgctgatgtatctgtaccggcagccgaacttcagcatcggcccggactcgtcc
gagaacgacgacgcggcgagcgtcgcgcaacaggccgcatcccaggccgcatccgcggcg
ggcgccgtgcgcgcgcggaagagcgccggcgcggcggccgcgccgcagctcgtgccgcag
ggcgggatgttctgggacggccgcgcggatacgctgcagcagcaggcgttcggcccgttg
atgaatccggtcgagatggcgaacgcgagcaccggcgacgtcgcgcgcaagctcgcgcac
gcgcgctacgcgccgcggttccggcagttgttcggcccgcgcatcttcgacgacgcacgt
cttgcggtgtccgaagcgatgttcgcgatcgcgcgctaccaggtggaggacccgtcgttc
catccgtattcgagcaagtacgaccgctggctcgaaggcgacgcgcggctcacgcaggcg
gagctgcgcggcatgcggcgcttcaacgatccgaacaaggcgaattgcgcgggctgccac
ctgtcgaagccgagcgcggacggtctgccgccgatgttcaccgatttccagtacgaggcg
ctcggcgtgccgcgcaaccgcgcgctcgcgcagaaccgcaatccggcgttccacgatctc
ggcatctgcgggccgtttcgcgacaacttgaagacgcagacgcaatactgcgcgatgttc
gcgacgccttcgctgcgcaacgtcgcgacgcgccgcgtgttcttccacaacggcgtctat
cattcgctcgaccgggtgctcgcgttctacaacctgcgcagcgtcgatccgggcaagatc
tatccgcgcgacgcaagcggccgggtgctgcaatacgacgacatcccgagcgcgtatcgc
gcgaacgtcgacgtcgccgatgcgccgttcgaccgcaagccgggcgacgcgcccgcgatg
accgagcaggacatgcgcgacatcgttgcgtttctgaacacgctgaccgacgagaagcgc
tga

DBGET integrated database retrieval system