KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A2451Help
Entry
BURPS1710b_A2451  CDS       T00289                                 

Gene name
rbsK
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bpm00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BURPS1710b_A2451 (rbsK)
Enzymes [BR:bpm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BURPS1710b_A2451 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(2964700..2965734)
Genome map
AA seq 344 aa AA seqDB search
MSARRRCDSMRMREAPGRHAPGVRDDTSLPRTHPMETIAVIGSNMVDLVTYVTRMPADGE
TLEAPNFELGCGGKGANQAVAASKLGARVAMISKLGDDLFAENTLRNFERFGVDTEHVRR
VSGVSSGVAPIFVSPDSRNRILIVKGANRHLRPADIDAAAAKIEASRLVVLQLEIDIDTV
YYAIDFAAARGIPVLLNPAPGVPDLDFARLAKLEFLVPNETELALVSGMPTDTPDAVERA
AGSLVERGVKHVIVTLGEKGSLLVSRAGAVRVPPVAVDARDTTGAGDAYIGCFARHYVAT
ADIPAAMRLASAYAAHSVTGLGTQKSYADAATFERFLQTIGFGA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgcgcgccgccgatgtgattccatgcggatgcgcgaggcgcctggccggcacgcg
cccggcgttcgcgacgacacttcacttccgaggacacaccccatggagacgatcgccgtc
atcggcagcaacatggtcgatctcgtgacctacgtcacgcggatgcccgccgacggagaa
acgctcgaagcgccgaacttcgagctcggctgcggcggcaagggcgcgaaccaggcggtt
gccgcgtcgaagctgggcgcgcgcgtcgcgatgatatcgaagctcggcgacgacctgttc
gccgagaacacgctgcgcaacttcgagcgcttcggcgtcgataccgagcacgtgcgccgc
gtgagcggcgtatcgagcggcgtcgcgccgattttcgtgagccccgattcgcgcaaccgc
atcctgatcgtcaagggtgcgaaccggcatctgaggccggccgacatcgacgcggccgcc
gcgaaaatcgaggcgagccgcctcgtcgtgctgcaactcgagatcgacatcgatacggtc
tactacgcaatcgatttcgccgccgcccgcggcattccggtgctgctgaatcccgcgccg
ggcgtgccggatctcgatttcgcgcgcctcgcgaagctcgagttcctcgtgccgaacgag
accgagctcgcgctcgtgtccggcatgccgaccgacacgcccgacgccgtcgagcgcgcg
gcgggctcgctcgtcgagcgcggcgtgaagcacgtgatcgtcacgctaggcgagaagggc
tcgctcctcgtgtcgcgcgcgggcgccgtgcgcgtgccgcccgttgccgtcgacgcgcgc
gacacgacaggcgcgggcgacgcgtacatcggctgcttcgcgcgccactatgtcgcaacg
gccgacatacccgccgcgatgcggctcgcctccgcgtacgccgcgcactcggtgacgggc
ctcggcacgcagaagtcgtacgcggatgccgcgacgttcgagcgcttcctgcagacgatc
ggcttcggcgcgtga

DBGET integrated database retrieval system