KEGG   Candidatus Blochmannia pennsylvanicus: BPEN_047Help
Entry
BPEN_047          CDS       T00272                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bpn  Candidatus Blochmannia pennsylvanicus
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bpn00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bpn00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
57272..58537
Genome map
AA seq 421 aa AA seqDB search
MTVDRFYIHGPTPLSGEVNISGAKNSALPILFATLLTEEPVEIFNVPKLKDIDVTIKLLT
QLGAKVDHCDVVFVDTSSVNTCCASYDLVKSMRASIWALGPLVARFGEGKIWLPGGCSIG
KRLVDLHVNGLEQLGATIILEEEYVTASVNGRLHGAHIIMDKISVGATVTIMSAAALAEG
VTIIDNAAREPEIVDTANFLIMLGTNINGAGSNRITIEGAQKLGGGKYSIMPDRIETGTF
LVAAAVSRTNVVCLGSRPDTLRFVIKKLRESGADINMGKDWIGLNMHGKRPKAVTVCTKP
YPGFPTDMQAQFTLLNIVSKGKGKIIETIFENRFMHVPELVRMGARIKILNNMIVCHGVD
SLIGTQVMATDLRASASLVLAGCIAEGLTIVDCVYHIDRGYDHIEKKLRNMGAHIKRVTN
K
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgacagtggatagattttatattcatggtcctactcctttaagtggtgaagtgaatata
tcaggtgctaaaaattctgcattaccaattttgtttgctacgttattaactgaggaaccg
gtagaaatttttaatgtgcctaaattaaaagatattgatgttactataaaattattaaca
caacttggagcaaaagtggatcattgcgatgtagtttttgtagatactagtagtgttaat
acgtgctgtgcatcctatgatctagttaaatccatgcgtgcttccatttgggcattagga
ccattagtagcacggtttggagaaggtaaaatttggctacctggaggatgttcaattggg
aaaagattagtagatttacatgttaatggtttggagcagttgggggcaacaattatctta
gaagaagagtatgttacagcttctgtgaatggacgattacatggtgctcatattatcatg
gataaaatcagtgttggagctacggttactatcatgagtgctgctgcattagcagaggga
gttactatcattgataatgctgctcgcgaaccagagattgttgatactgctaattttctt
attatgttaggaactaatattaacggagctggaagcaatagaattactatcgaaggggct
caaaaattaggagggggaaagtattcaattatgccagatcgcattgaaactggtaccttt
ttagttgctgccgctgtttcacgtacaaatgtagtatgtttggggtctcgtccggatacg
ttgcgttttgtgataaaaaaattacgtgaatctggtgctgatattaatatgggtaaagat
tggatcggtttgaacatgcatgggaaaagacctaaagctgttactgtatgcacgaagccg
tatccagggtttcctactgatatgcaagcacagtttactttattaaatatagtctccaaa
ggaaagggaaaaattatagagactatatttgaaaataggtttatgcacgtaccagagctt
gttcgtatgggagctcgtattaaaatattaaacaatatgattgtttgtcatggtgttgat
tcattaattggtactcaagttatggcaacggacttgcgggcttctgcaagcttagtattg
gctggttgtattgctgaaggcttgacgatagtggattgtgtatatcatattgatcgagga
tatgatcatattgaaaaaaagttaagaaatatgggagctcatataaaacgggttactaat
aaatag

DBGET integrated database retrieval system