KEGG   Candidatus Blochmannia pennsylvanicus (Camponotus pennsylvanicus): BPEN_117Help
Entry
BPEN_117          CDS       T00272                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bpn  Candidatus Blochmannia pennsylvanicus (Camponotus pennsylvanicus)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bpn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BPEN_117 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BPEN_117 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BPEN_117 (thrC)
Enzymes [BR:bpn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BPEN_117 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
139712..141013
Genome map
AA seq 433 aa AA seqDB search
MKLYNIKQPSEQVTFTQALLQGLGKNQGLFFPKDLPKFSIFEINSLLEMSFIERSTHILS
TYIGSELSKNSILTCVKNAFNFPVPLVCINNNVAILELFHGPTLAFKDFGSRLMAQMLNQ
TNHCSDKPMVILTATSGDTGAAVAHAFFNLSNIHVIILYPRGKISALQEKLFCTLGGNIS
TISVNGDFDSCQRLVKKAFDDSVLRQKLNLNSANSINIGRLLAQICYYFEGVSQLPHQMR
NKLVIAVPSGNFGNLTAGLLAQSCGLPVKKFIAATNINDTVPRFLEFGYWEPRPTLSTFS
NAMDVSSPNNWSRIEELFRRENKSIKELEYGCVNDFLTEKTVQEIADLGYLSEPHTAVAY
RLLCDKLHSDEFGICLGTAHPVKFKELVEDFLKKKIQLILPIVLKERMKLPVLSFKIPKC
FSSLRNLILSIMS
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaaactatataatattaagcaacctagtgaacaagtcacgtttactcaagctctctta
caaggattaggaaaaaatcaggggttatttttcccaaaagatcttccaaaattctctata
tttgaaataaattctctcttagaaatgagttttatagaacgtagtacgcatattttgtct
acatatattggctctgaattatcaaaaaatagtatattaacttgtgttaaaaatgctttt
aattttccagtcccattagtgtgtataaataataatgttgcaattttagaactttttcat
ggcccaactttggcttttaaagattttggaagccgattaatggcgcaaatgttaaatcag
actaaccattgttctgataaaccaatggttattctgactgctacttctggagatacaggt
gctgctgtagcccatgctttttttaatttaagcaatatacatgttataattctttaccct
agaggcaagattagtgcattacaagaaaaattattttgcactttaggaggcaatatttct
acaatatcagtaaatggagattttgattcatgtcaacgtttagttaagaaagcttttgat
gacagtgtactgcgacagaaattaaatttaaattctgcgaattccattaacattggccga
ttattagctcaaatttgttactattttgaaggggtatcacaattaccgcatcaaatgcgt
aataaattagttattgcggttcctagcggtaattttggaaatttaacagcaggactatta
gctcaatcttgtggattaccagtaaagaagtttattgctgctactaatattaatgatact
gtgcctagatttttagagtttggttattgggaacctcgccctactctttcaacgttttct
aatgctatggatgtaagctctccaaataattggtctagaatagaagaattgtttcgtcga
gaaaataaatctattaaagaattggaatatggttgtgttaatgattttctcaccgagaaa
acagtccaagaaattgcagatttgggatatctttccgaacctcataccgctgtagcatat
cgattactgtgtgataaattacattctgatgaatttggtatatgtcttggtactgctcat
cctgttaaatttaaagagttagtagaggattttttaaaaaaaaagatacaattaatatta
ccaattgtattaaaagaacgtatgaaattacctgttttatcgtttaaaatacctaaatgt
ttctcttcattacgtaacctaattttaagcataatgtcttaa

DBGET integrated database retrieval system