KEGG   Candidatus Blochmannia pennsylvanicus (Camponotus pennsylvanicus): BPEN_128Help
Entry
BPEN_128          CDS       T00272                                 

Gene name
folA
Definition
dihydrofolate reductase type I
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bpn  Candidatus Blochmannia pennsylvanicus (Camponotus pennsylvanicus)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BPEN_128 (folA)
   00670 One carbon pool by folate
    BPEN_128 (folA)
Enzymes [BR:bpn01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     BPEN_128 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
156320..156814
Genome map
AA seq 164 aa AA seqDB search
MIISLIAALTTNHIIGKKNVIPWYLPIDIKWFKYHTLYKPIIMGRKTFESIGKKPLLNRL
NIVLSRNLLNNYNGVFIAENIDEALSLIQDAYEVMVIGGSEIYNVFLPRAQRLYLTYIHN
MVEIDGDILFPDYDIREWKSIFNSFYKVREDCFCYLHFSILERY
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgattattagcttaattgctgcgttgactaccaatcatataattggaaaaaaaaatgtt
attccttggtatttacctatagatattaagtggtttaagtatcatactttatataagcca
attattatgggacgcaaaacattcgagtctataggtaagaaaccattattaaatagattg
aatattgtgttaagtcgtaatttattaaataattataatggtgtttttatagcggaaaat
atagatgaagctttatctttaatacaggacgcatatgaagttatggtaattggaggcagt
gaaatatacaatgtttttttacctcgtgcgcaacgcttatatttaacatatattcataac
atggttgaaattgatggtgacattttgtttcctgattatgatataagagaatggaaatct
attttcaatagtttctataaagttagagaggattgtttttgttatttgcatttttctatt
ttagaacgctactaa

DBGET integrated database retrieval system