KEGG   Candidatus Blochmannia pennsylvanicus: BPEN_128Help
Entry
BPEN_128          CDS       T00272                                 

Gene name
folA
Definition
dihydrofolate reductase type I
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bpn  Candidatus Blochmannia pennsylvanicus
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bpn00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:bpn00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
156320..156814
Genome map
AA seq 164 aa AA seqDB search
MIISLIAALTTNHIIGKKNVIPWYLPIDIKWFKYHTLYKPIIMGRKTFESIGKKPLLNRL
NIVLSRNLLNNYNGVFIAENIDEALSLIQDAYEVMVIGGSEIYNVFLPRAQRLYLTYIHN
MVEIDGDILFPDYDIREWKSIFNSFYKVREDCFCYLHFSILERY
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgattattagcttaattgctgcgttgactaccaatcatataattggaaaaaaaaatgtt
attccttggtatttacctatagatattaagtggtttaagtatcatactttatataagcca
attattatgggacgcaaaacattcgagtctataggtaagaaaccattattaaatagattg
aatattgtgttaagtcgtaatttattaaataattataatggtgtttttatagcggaaaat
atagatgaagctttatctttaatacaggacgcatatgaagttatggtaattggaggcagt
gaaatatacaatgtttttttacctcgtgcgcaacgcttatatttaacatatattcataac
atggttgaaattgatggtgacattttgtttcctgattatgatataagagaatggaaatct
attttcaatagtttctataaagttagagaggattgtttttgttatttgcatttttctatt
ttagaacgctactaa

DBGET integrated database retrieval system