KEGG   Candidatus Blochmannia pennsylvanicus: BPEN_155Help
Entry
BPEN_155          CDS       T00272                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bpn  Candidatus Blochmannia pennsylvanicus
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BPEN_155 (folK)
Enzymes [BR:bpn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     BPEN_155 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
191738..192232
Genome map
AA seq 164 aa AA seqDB search
MERVWVSIGSNLLNPKQQADRAIWSLSKLPMTRLIDFSSYYRSLPLGDKNQPDFLNAIII
LDTNLSPKGLLSHMQYIERKQGRARRSRDSLIWQPRTLDLDILLFGKYFTYSTELTIPHH
GLLNREFVLYPLMALDNNFIFPNGSVITDIVKTVPKNDLDFWQE
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atggaacgagtttgggtcagcattggtagtaatctgttaaatccaaaacaacaagcggat
cgtgctatctggtctctttctaagcttccaatgactagacttatagatttttcttcctat
tatcgtagtctgccattaggagataaaaatcagcccgattttctaaatgcgataataatt
ctagatactaatttatctccaaaaggattattaagtcatatgcaatatatcgaacgaaaa
caaggacgtgcacgacgatcacgggattctcttatatggcagccacgtactttagattta
gatatcttactatttggaaaatactttacatatagtactgaattgacaataccgcatcat
ggtttgcttaatcgagagttcgtactttatccattgatggcattagataataatttcatt
tttcctaatgggagcgttataacagatatcgttaaaactgtacctaaaaatgatttagat
ttttggcaggaataa

DBGET integrated database retrieval system