KEGG   Candidatus Blochmannia pennsylvanicus: BPEN_156Help
Entry
BPEN_156          CDS       T00272                                 

Gene name
lpdA
Definition
dihydrolipoamide dehydrogenase, FAD/NAD(P)-binding, E3 component of the 2-oxoglutarate dehydrogenase and the pyruvate dehydrogenase complexes
Orthology
K00382  
dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
bpn  Candidatus Blochmannia pennsylvanicus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Glycine, serine and threonine metabolism
Valine, leucine and isoleucine degradation
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:bpn01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bpn00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bpn00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bpn00620]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bpn00260]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:bpn00280]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(193981..195405)
Genome map
AA seq 474 aa AA seqDB search
MYIKIKTQILVLGAGPGGYSAAFRCADLGMDTTIVERYPDLGGVCLNVGCIPSKTLLHIA
KLIETQKKFNKYGLLSGETHIDLNKTRSWKDKIIDQLSNSLSAMAKKRNVKVIDGVGKFI
DSHTIQVENNEMTLEIAFNYAIVAAGSHTVSLPCIPNDQRIWNSTDALSLQSIPERLLII
GSGAIGLEMATIYRAFGSEIDIVEMCNRIMPILDEDITNIFTKIITKNINLILNTKVNIV
EAKKDGIYVTMENKQTLLKNTQRYDALLVAIGRAPNGNMLNIERAGVNVNEYGFIPVDKQ
MRTNVQHIFAIGDIIGYPMLAHKSIHEGHVAAEVISGKKRCFDPIIIPSIIYTDPEIAWV
GYTEKSAQEKNIDYEVALFPWMASGRAITEDCKEGITKLIFNKKTNRIIGGSILGANASE
ILGEIALAIEMGCDVEDITLTIHAHPTLYESIALAASIHNGSITDLPNIKKQTQ
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgtatataaaaataaaaactcaaattcttgttttaggcgcgggaccaggaggttattcc
gcggcttttcgctgcgctgatttaggtatggatactacaatagtagaacgttatcctgat
ttaggtggagtgtgtcttaatgttggttgtattccgtctaaaacattattacatattgcc
aaattaattgaaacacaaaaaaaattcaataaatatggtctcctgtcaggagaaacacat
atcgatcttaataagacgcgctcttggaaagataaaattattgatcaattgtcaaatagt
ttgagtgctatggcaaaaaaacggaacgttaaagtaattgatggggttggtaaatttatt
gatagtcatactattcaagttgaaaacaatgaaatgaccttagaaatagcattcaattac
gctattgtagcagcaggatcacatactgtatcactaccatgtattcctaatgatcagcga
atttggaattcaactgatgctctatctttacaatcaatacccgaacgtttactaattata
ggctcaggagctataggattagaaatggccacaatatatcgtgcttttggatcagaaata
gatatagtagaaatgtgtaatcgaatcatgccaattttagatgaagatattactaatatt
tttactaaaataattactaaaaatattaatttaattttaaatactaaagttaacatagta
gaagctaagaaagatggtatttatgtaactatggaaaataaacaaactttattaaaaaat
actcaacgttatgatgcattattagtagcaattgggcgcgctccaaatggtaacatgttg
aatatcgagcgtgcgggagtaaatgtaaatgaatatggtttcattcctgtagataagcag
atgcgtactaatgttcaacacatttttgctattggagatattattggatatccaatgcta
gctcataaaagtattcatgaaggacatgtagctgcagaagttatttccggtaaaaaacgt
tgttttgatccaataataattccatccattatatatactgatccagaaatagcgtgggtt
ggatatactgaaaaaagtgctcaagaaaaaaatatagattatgaagttgcacttttccct
tggatggcttcaggtcgagcaattactgaagattgtaaagaaggcataaccaaattaatt
tttaataaaaaaacgaacagaattattgggggatcaatattaggcgcgaatgctagtgaa
atattaggagaaattgcattagccattgaaatgggatgtgatgtagaagatattactcta
accattcatgcccatccaaccttatatgaatcaatagcattagcagcatctattcataat
ggatcaattactgatttgcctaatataaaaaaacaaacacaataa

DBGET integrated database retrieval system