KEGG   Candidatus Blochmannia pennsylvanicus (Camponotus pennsylvanicus): BPEN_260Help
Entry
BPEN_260          CDS       T00272                                 

Gene name
speB
Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bpn  Candidatus Blochmannia pennsylvanicus (Camponotus pennsylvanicus)
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpn00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BPEN_260 (speB)
Enzymes [BR:bpn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     BPEN_260 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
295662..296582
Genome map
AA seq 306 aa AA seqDB search
MNTLNYKNDSSLFSNSFGFLRFPLEFDPYNSNSDWVITGVPFDLATSGRSGSRFGPTAIR
QASINLAWEHFRWPWNVNIRKNLHIIDCGDLIYKSGDIQDFTSSLQNHAENLLMSGKKML
SFGGDHYITLPILRAYAKFFGKLAIIHFDAHADYYDNDSKYDHGVVILHALNEKLIDPVH
SIQIGIRTEYKKCFGFTVLDVEYINDTNIDVIINKITSIAQSFPVYLTFDIDCLDPAIAP
GTGTPVIGGLTSYRVLKLIRGFQHLNIIGIDLVEVAPAYDCAQITALAAATIGLEMLYTQ
VKSKKN
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaacactttgaattataaaaatgatagctccttattttcaaattcctttggattttta
cgatttccattagaattcgatccttataatagtaatagtgattgggtaattactggagtt
ccttttgatttggctacgtctggtcgctcaggaagtagatttggaccaaccgctattaga
caggcatctattaatttagcctgggaacattttcgttggccttggaacgtgaatatacgc
aagaatttacacataattgactgcggagatttaatatataaatctggagacatacaagat
ttcaccagttctctacaaaaccatgctgaaaatttactaatgtctggaaaaaaaatgtta
tcatttggaggcgatcattatatcacattacctatattacgtgcgtatgcaaaatttttt
ggaaaattagcaataatacattttgacgcacatgcagattattatgataacgatagtaaa
tatgatcacggtgttgtaatattacatgctcttaatgaaaaattaatagatcctgtacat
tcaatacaaattggtattcgtaccgaatacaaaaaatgtttcggatttacagtgctagat
gtagagtatattaatgatactaacattgatgttatcataaataaaataacatcaatcgct
caatcctttccagtatatttaactttcgatattgattgtttggatccagctatagcacct
ggtactgggactccagtaattggaggattaacaagttaccgtgtattaaaattaatacga
ggttttcaacatttaaatattataggtattgatttagtagaggtagctccagcttatgat
tgcgcacaaattactgctttagcagcagctacaatagggttggaaatgctttatactcaa
gtgaaatcaaagaagaattaa

DBGET integrated database retrieval system