KEGG   Candidatus Blochmannia pennsylvanicus: BPEN_338Help
Entry
BPEN_338          CDS       T00272                                 

Gene name
sdhD
Definition
succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
bpn  Candidatus Blochmannia pennsylvanicus
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:bpn01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bpn00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bpn00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:bpn00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
399742..400089
Genome map
AA seq 115 aa AA seqDB search
MVSIKSILKYHGVYEWLLVRISAVWMLLYIVYISIFIISANNLSYDKWYDFFSKNTTKIF
SIMVLLSALNHAWIGMRHILEDYITLPVLRQLGVWITGSILFAYLFFGMIIIWSV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtatccattaaatcaattttgaaatatcacggagtgtacgaatggttgctagtacga
atttcagccgtctggatgttgctatacatcgtgtatatttctatttttattatttcagct
aacaacttatcttatgataaatggtacgatttttttagcaaaaacaccaccaaaatattt
agtatcatggttttgttatctgccctaaatcatgcttggattggtatgcgccacatacta
gaagactatataacattacctgtgctaaggcagttaggagtatggataaccggttctata
ttgttcgcatacttattttttgggatgattatcatttggagtgtatag

DBGET integrated database retrieval system