KEGG   Candidatus Blochmannia pennsylvanicus (Camponotus pennsylvanicus): BPEN_342Help
Entry
BPEN_342          CDS       T00272                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase E2 component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bpn  Candidatus Blochmannia pennsylvanicus (Camponotus pennsylvanicus)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bpn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BPEN_342 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BPEN_342 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    BPEN_342 (sucB)
Enzymes [BR:bpn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BPEN_342 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
405720..406964
Genome map
AA seq 414 aa AA seqDB search
MSSIDIVVPNLPESVADATVAVWHKKSGDTVKQDDILLEIETDKIMLEIPAPNTGILESI
SEQEGSTVVSGQILGRLNIDHIVSQKDTKKIFQDQKSITSVASQEHILTRDNKNHNILTP
SIRKLMTEHNLQLTNIQGSGIKGRLTRQDIESHIHSEKKLHYTNQQNNENVAHHHIQNTK
NDRKETRIVMNRLRKKISERLLAVTKTTAMLTTFNEVNMQPIIKLRKKYGELFEKRYGIT
LGIMSFYVKAVLEGLRHFPEINASIDGEEIVYYHYFDISIAVSTVRGLITPVLRDIDTLS
MSDIEKNIKSLAEKGRDGKLTIEELSGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAI
KDRPIAQDGQIVILPMMYLALSYDHRLIDGKDSVRFLVYIKELLEDPTRLFLEI
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtattgacattgtggttccgaatttaccagaatcggttgcagacgctactgtt
gctgtttggcataaaaaatcaggagatacagttaaacaagatgatattttactggaaata
gaaacagacaaaattatgttagaaattcccgctccaaacacaggaattttagaatcaatt
tcagaacaagagggatcaacagtagtatccggccaaattttaggccgtctaaatattgat
catatcgtttcccaaaaagatacaaaaaaaatatttcaagatcaaaaatctattacatca
gtagcatctcaagaacatattcttacccgagataacaaaaatcataacattttaactcca
tctattcgcaaattaatgacagagcataatttacagctaacaaatattcaaggcagtgga
ataaaaggacgtctaactcgtcaagatatagagtcacatattcattccgaaaaaaaatta
cattatactaatcaacaaaataatgaaaatgtagcgcatcatcacatacaaaatacaaaa
aacgatcgcaaagaaacacgtattgtaatgaatcgattacgaaaaaaaatctcagaacgc
ctattagctgttactaaaactacagctatgttaactacttttaatgaagtaaacatgcaa
cccatcataaaactgcgaaaaaaatatggagaattatttgaaaaacgttatggaattaca
ttaggaatcatgtctttttatgtaaaagcagttttagaaggattgagacattttcctgaa
attaatgcatctattgatggagaagaaattgtatattatcattattttgatataagtatt
gcagtatctacagtacgtggtttaattactccagtgttacgagatatcgatacattaagc
atgtctgacatagaaaaaaatataaaatctttggctgaaaaaggaagagacggtaaacta
acaattgaagaattaagcggaggtaattttaccattactaacggtggagtttttgggtca
ttaatgtctactcctatcattaatcctccacaaagcgcaattcttggtatgcatgcaata
aaggaccgacccatagctcaagatgggcagatagtaatattacctatgatgtatttagca
ttatcatatgatcatagattaatagatggaaaagattcggtaagatttctagtatatatc
aaagagttgttagaagacccaacacgcttgtttttagaaatataa

DBGET integrated database retrieval system