KEGG   Candidatus Blochmannia pennsylvanicus (Camponotus pennsylvanicus): BPEN_343Help
Entry
BPEN_343          CDS       T00272                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase, beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bpn  Candidatus Blochmannia pennsylvanicus (Camponotus pennsylvanicus)
Pathway
bpn00020  Citrate cycle (TCA cycle)
bpn00640  Propanoate metabolism
bpn00660  C5-Branched dibasic acid metabolism
bpn01100  Metabolic pathways
bpn01110  Biosynthesis of secondary metabolites
bpn01120  Microbial metabolism in diverse environments
bpn01130  Biosynthesis of antibiotics
bpn01200  Carbon metabolism
Module
bpn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bpn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BPEN_343 (sucC)
   00640 Propanoate metabolism
    BPEN_343 (sucC)
   00660 C5-Branched dibasic acid metabolism
    BPEN_343 (sucC)
Enzymes [BR:bpn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BPEN_343 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: AAZ40968
UniProt: Q492X4
Position
407081..408256
Genome map
AA seq 391 aa AA seqDB search
MNLYEYQAKKLMEKYNLPVLKGFVCATINDIEHCIVSNSIGYGPWVVKCQVRAGGRGKSG
GVCLVHSTKNILSFANKWLGNRLITYQTTDTGELVTSILIEPAVKIIQEFYLSISIDRDE
SQIICMASTQGGMNIEITEQKTPNFIHKIVINPSVGIYPYQGRILACKLGLSGAKINQFS
RIIVSITRMLLEHDLTLIEINPLAITDDDYFYCLDAKMIVDRNAIFRQSELLNICAINKP
IDMLNFINYIPLEGNIGCMVNGAGLAMATMDVIKSLGGIPANFLDIGGGANKECIISAFN
MILKNAKVQAILVNIFGGIVCCDLVAECIITALARYTTKHIPIVARLEGNNSTLGSNRLI
NSKLNIIVTDNLIYAIQQSVTAVNLKNVNFS
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaacttatatgaatatcaagcaaaaaaattaatggaaaaatacaatttacctgttttg
aaaggttttgtatgtgctactataaatgatatagagcattgtattgtatcaaatagcata
ggttatggcccatgggtagtaaaatgtcaagtgcgagcaggagggcgcgggaaatcagga
ggagtatgtcttgtacattccacgaaaaatatattatcttttgctaataaatggcttggt
aatagattgataacatatcaaactaccgataccggggaattagtgacttctattttaata
gaaccagctgtaaaaattattcaagaattttatttaagcatatcaattgatagagatgaa
tcccaaataatatgtatggcttctacgcaaggtggtatgaacattgaaattacagaacaa
aaaacacctaattttattcacaaaattgtcataaatccttcagtaggaatatatccgtat
caaggacggatattagcatgtaaattaggcttatctggagccaaaataaatcaattttcc
agaattattgttagcataacacgtatgttgctggaacatgacctaacgttaattgaaatt
aatccattagctattactgatgatgattatttttattgtttagatgccaaaatgattgta
gatcgtaatgctatatttagacaatcagaattgttaaatatatgcgctataaataaacca
atcgatatgctgaattttatcaattacattcccttggagggaaatattggctgtatggtc
aatggtgctgggttagcaatggctactatggatgtaattaaatcattaggagggattcct
gctaattttttagacatcgggggaggtgctaataaagaatgcataatatcagcttttaat
atgattttaaaaaatgctaaagtgcaagcgatacttgtaaatatttttgggggaattgta
tgctgtgatttagtcgctgagtgtatcataactgcattggccagatataccacaaaacat
attcctattgtggctcggttagaaggaaataattctacattaggttctaatcgattaatt
aatagcaaacttaatattattgttaccgataatttaatttatgcaattcaacaaagtgta
actgcggtgaacttaaaaaatgtcaattttagttaa

DBGET integrated database retrieval system