KEGG   Candidatus Blochmannia pennsylvanicus (Camponotus pennsylvanicus): BPEN_352Help
Entry
BPEN_352          CDS       T00272                                 

Gene name
gpmA
Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bpn  Candidatus Blochmannia pennsylvanicus (Camponotus pennsylvanicus)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bpn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BPEN_352 (gpmA)
   01230 Biosynthesis of amino acids
    BPEN_352 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BPEN_352 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    BPEN_352 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BPEN_352 (gpmA)
Enzymes [BR:bpn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BPEN_352 (gpmA)
Exosome [BR:bpn04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BPEN_352 (gpmA)
  Exosomal proteins of melanoma cells
   BPEN_352 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
417047..417745
Genome map
AA seq 232 aa AA seqDB search
MHITKLVLIRHGESQWNKENRFTGWVDVDLSEKGRSEAQCAGRILKKNGFFFNYGYTSVL
KRAIHTLWIILDQLDQAWLPIEKSWRLNERHYGALQGLNKDEAIKEYGYKTIQKWRRSFN
VIPPNICGGNNQFIATNDNRYANISTDELPSSESLELTLKRVIPYWNQSIIPHIKKGQTI
IIVAHGNSIRAIIKFLNHLNESEIFQINVPTGVPLIYEFDKKANTVQHYYLK
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgcatataactaaattagttttaataagacacggagaaagtcaatggaacaaagaaaat
agattcactggatgggttgatgtagacttatcagaaaaaggacgttctgaagcgcaatgc
gctggtagaatattaaaaaaaaatggatttttttttaattatggatatacttcagtatta
aaacgagcaattcatactttatggatcatattagatcaattagatcaagcatggctacca
atagaaaaatcttggcgactcaatgaacgtcattatggggcactgcaaggattaaataaa
gatgaagccataaaagaatatggatacaaaacaattcaaaaatggcgtcgtagtttcaat
gttattcctccaaatatttgtggtggaaataatcagtttattgcaacaaatgacaatcgt
tatgctaacatcagtactgatgaattacctagtagtgaaagtttagaactaaccttaaaa
agagtaatcccttattggaaccaatccataatacctcatatcaaaaaaggtcaaacaatt
attatcgttgcccatggaaattctatacgcgctataataaagtttctcaatcacttaaat
gaatcagaaatatttcaaattaatgtgccaacaggtgttccgctaatatatgaatttgac
aaaaaagcaaatactgttcaacattattatttaaaataa

DBGET integrated database retrieval system