KEGG   Candidatus Blochmannia pennsylvanicus (Camponotus pennsylvanicus): BPEN_352Help
Entry
BPEN_352          CDS       T00272                                 

Gene name
gpmA
Definition
(GenBank) phosphoglycerate mutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bpn  Candidatus Blochmannia pennsylvanicus (Camponotus pennsylvanicus)
Pathway
bpn00010  Glycolysis / Gluconeogenesis
bpn00260  Glycine, serine and threonine metabolism
bpn00680  Methane metabolism
bpn01100  Metabolic pathways
bpn01110  Biosynthesis of secondary metabolites
bpn01120  Microbial metabolism in diverse environments
bpn01130  Biosynthesis of antibiotics
bpn01200  Carbon metabolism
bpn01230  Biosynthesis of amino acids
Module
bpn_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bpn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BPEN_352 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    BPEN_352 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BPEN_352 (gpmA)
Enzymes [BR:bpn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BPEN_352 (gpmA)
Membrane trafficking [BR:bpn04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BPEN_352 (gpmA)
Exosome [BR:bpn04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BPEN_352 (gpmA)
  Exosomal proteins of melanoma cells
   BPEN_352 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AAZ40977
UniProt: Q492W5
Position
417047..417745
Genome map
AA seq 232 aa AA seqDB search
MHITKLVLIRHGESQWNKENRFTGWVDVDLSEKGRSEAQCAGRILKKNGFFFNYGYTSVL
KRAIHTLWIILDQLDQAWLPIEKSWRLNERHYGALQGLNKDEAIKEYGYKTIQKWRRSFN
VIPPNICGGNNQFIATNDNRYANISTDELPSSESLELTLKRVIPYWNQSIIPHIKKGQTI
IIVAHGNSIRAIIKFLNHLNESEIFQINVPTGVPLIYEFDKKANTVQHYYLK
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgcatataactaaattagttttaataagacacggagaaagtcaatggaacaaagaaaat
agattcactggatgggttgatgtagacttatcagaaaaaggacgttctgaagcgcaatgc
gctggtagaatattaaaaaaaaatggatttttttttaattatggatatacttcagtatta
aaacgagcaattcatactttatggatcatattagatcaattagatcaagcatggctacca
atagaaaaatcttggcgactcaatgaacgtcattatggggcactgcaaggattaaataaa
gatgaagccataaaagaatatggatacaaaacaattcaaaaatggcgtcgtagtttcaat
gttattcctccaaatatttgtggtggaaataatcagtttattgcaacaaatgacaatcgt
tatgctaacatcagtactgatgaattacctagtagtgaaagtttagaactaaccttaaaa
agagtaatcccttattggaaccaatccataatacctcatatcaaaaaaggtcaaacaatt
attatcgttgcccatggaaattctatacgcgctataataaagtttctcaatcacttaaat
gaatcagaaatatttcaaattaatgtgccaacaggtgttccgctaatatatgaatttgac
aaaaaagcaaatactgttcaacattattatttaaaataa

DBGET integrated database retrieval system