KEGG   Candidatus Blochmannia pennsylvanicus (Camponotus pennsylvanicus): BPEN_442Help
Entry
BPEN_442          CDS       T00272                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bpn  Candidatus Blochmannia pennsylvanicus (Camponotus pennsylvanicus)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bpn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BPEN_442 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BPEN_442 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BPEN_442 (trpB)
Enzymes [BR:bpn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BPEN_442 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
523423..524613
Genome map
AA seq 396 aa AA seqDB search
MIKLKSYFGEFGGMYVPQILIPALTQLEEAFISAQDDAIFQKELKYLLNNYAGRPTPLTL
CRNLTKGTRAKLYLKREDLLHGGSHKTNQVLGQALLAKRMSKTEIIAETGAGQHGVAVSI
AASLLGLKCRIYMGSKDIKRQKLNVLRMQLMGTQVIPVHRGSETLKDACNEAMREWSKTY
EYTHYMLGTAAGPHPFPTIVREFQRIIGKETYKQIQKYEQCLPDAIIACVGGGSNAIGIF
SDFVDIPSVQLLGVEAGGLGINTEYHGAALQHGSIGIYFGMKTSILQSSEGQVKNSYSVS
AGLDFPSVGPEHVYLKNTGRVQYVSINDIEAITAFKKLSIHEGIIPALESAHALAHALKI
IQKQPDKAQILVVNLSGRGDKDISTVHNALQKERDK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgataaaattaaaatcctattttggagaatttggaggtatgtatgtaccgcaaattcta
ataccagccctaactcaattagaagaagcatttatatcagctcaagatgatgctattttc
caaaaagaactcaaatatcttttaaacaactatgccggtcgtcctactcctttgacatta
tgtagaaatttaacaaaaggaactcgcgctaaactgtatttaaaacgtgaagacttattg
catggaggatctcataaaaccaaccaagtattaggacaagctttattagcaaaacgtatg
tctaaaacagaaataatcgctgaaactggtgccggacaacatggagtggctgtctccatt
gcagcctctcttttaggattaaaatgtcgtatttatatgggatctaaagatataaaacgt
caaaaactcaacgttttgagaatgcaattaatgggcacacaagttattccagtacatcgt
ggatctgaaactttaaaagatgcttgtaacgaagccatgcgcgaatggtcgaaaacttat
gaatacacccattacatgcttggtacagctgctggacctcatccttttcccacaatcgtt
agagaatttcaacgtattattggaaaagaaacatacaaacaaatacaaaaatatgagcaa
tgcttaccagatgcaattattgcttgcgtaggaggaggatctaatgctattggcatattt
tctgattttgttgacataccatcagtgcagttattaggtgtagaagctggaggattaggt
ataaatactgaatatcatggtgccgctctacaacatggaagtataggaatttattttggt
atgaaaacttcaatcttacaatcttcggaaggacaagtaaaaaactcttattctgtttcc
gctggtctcgattttccgtctgtcggtccagagcatgtttatctaaaaaatactggccgg
gtacagtatgtatctattaatgatatagaagccataacagcttttaagaaattatctatt
catgaaggaattattccagctctagaatccgctcatgctttagctcatgcactaaaaata
attcagaaacaaccagataaagcacaaattttagtagttaatttgtctggacgtggagat
aaagacatttctaccgttcataatgcattacaaaaagaaagagataaataa

DBGET integrated database retrieval system