KEGG   Candidatus Blochmannia pennsylvanicus (Camponotus pennsylvanicus): BPEN_478Help
Entry
BPEN_478          CDS       T00272                                 

Gene name
hisD
Definition
(GenBank) L-histidinal:NAD+ dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
bpn  Candidatus Blochmannia pennsylvanicus (Camponotus pennsylvanicus)
Pathway
bpn00340  Histidine metabolism
bpn01100  Metabolic pathways
bpn01110  Biosynthesis of secondary metabolites
bpn01230  Biosynthesis of amino acids
Module
bpn_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:bpn00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    BPEN_478 (hisD)
Enzymes [BR:bpn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     BPEN_478 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh WbqC
Motif
Other DBs
NCBI-ProteinID: AAZ41094
UniProt: Q492K3
Position
570629..571960
Genome map
AA seq 443 aa AA seqDB search
MISHEHPISIYWNDCSKSEQKKLLTRPINNKLNDIYINVKNILTKVYNEGDRALFKFNFD
FDNVQTTQLQIPTEIIMNSGRNLSNEIKQAIHTAMTNITRFHQAQCYSEIIVETLPGVYC
QQIIRPLNIVGLYVPGGTAPLLSTVMMLGVPARIAKCKRVILCSPPPIPDVIIYTAQLCG
IDEIYQIGGSQSIAAMGFGTESIPKVDKIFGPGNIWVTEAKRQINLAPNGAAIDMLAGPS
EILIIADNTANPIFIAADLLSQSEHGPDSHAILITPYSCIAEKTKKELHKQLKILPRNDI
VRNVLLNSRMIITNNLMECFSISNSYAPEHLIIQIENASDYLHYITNAGSIFLGNWSPET
AGDYASGPNHVLPTYGRAVATSGLGVIDFQKRMSVQQLTQNGLLQLSSTITTLTQIEQLK
AHEYAITHRINYIKEQNEHSLLG
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgatttctcatgaacatcctatatctatttattggaatgattgttccaaatctgaacaa
aaaaaactgctgacccgtccaataaataacaaattaaacgatatttatataaatgttaaa
aatatacttacaaaagtttataacgaaggcgatcgtgctttatttaaatttaattttgat
tttgacaacgtccaaactacacaattgcaaatcccaactgaaattatcatgaattcggga
cgtaacttgtctaatgaaataaaacaagcaatacataccgccatgaccaatataacacgg
tttcatcaagcacaatgttattcagagataatcgtggaaactcttccaggcgtatattgc
caacaaattattcgcccattaaatattgttggactatatgtaccaggaggaactgcaccg
ctgttgtcaacagttatgatgttaggtgtcccagctcgtattgcaaaatgtaaacgtgta
atattatgttcacccccaccaattccggacgtaattatatataccgcacaactttgcggt
atcgacgaaatttatcaaataggaggtagtcaatctatagccgctatgggatttggcact
gagtctattccgaaagtagataagatatttggaccaggtaatatatgggttacagaagca
aaacgacaaattaatcttgctccaaatggagctgctattgatatgctagctggaccttcc
gaaatattaattattgcagataatacggctaatcctatttttatcgcagcagaccttttg
tcacaatcagagcacggacctgattcgcacgcaatacttataacgccctactcgtgcatt
gcagaaaaaacaaaaaaagagctacataaacaattaaaaatattaccacgaaatgatatc
gttcgtaacgtattattgaatagtcgcatgattattactaataatttaatggaatgtttt
tctataagcaatagctatgctccagagcatttgattattcaaattgaaaatgcatcagat
tatttacattacatcacgaatgccggatcaatattccttggaaattggtctccggaaact
gctggagattatgcaagcgggcctaatcacgttttacctacatacgggcgcgcagttgcc
acatctggtctaggagttatagattttcaaaaaagaatgtcggtacaacaattaacccaa
aatggattattgcagctatcatcaaccattacaacattaacacaaatcgaacaattaaaa
gctcatgaatatgccataacacatcgtataaactatatcaaggaacaaaatgaacattcg
ttacttggctag

DBGET integrated database retrieval system