KEGG   Candidatus Blochmannia pennsylvanicus (Camponotus pennsylvanicus): BPEN_602Help
Entry
BPEN_602          CDS       T00272                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bpn  Candidatus Blochmannia pennsylvanicus (Camponotus pennsylvanicus)
Pathway
bpn00860  Porphyrin and chlorophyll metabolism
bpn01100  Metabolic pathways
bpn01110  Biosynthesis of secondary metabolites
bpn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BPEN_602 (hemD)
Enzymes [BR:bpn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BPEN_602 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AAZ41207
UniProt: Q491Z5
Position
724900..725649
Genome map
AA seq 249 aa AA seqDB search
MNILITRPSPYGEQLVNKLLSFGKFAYHLPLIYFSTGKELCSLEQKLNLLSEGDFLCIIS
QHAIKYAHNQLLNMGISWPTKLAYYSIGHATSVMMYKLSGILVKYPTIQETSENLLQLPE
LMYSYGKRALILRGNNGRTILDDTLQRRGVFVASCECYTRQPFRYNREKQLSNLLGLNIR
TVVVTSGEILQHLYYLIPESYRTSWLIRCKLIVVSVRLAKLARRLGWTNIIIAQSANNEI
LFHLLIKNS
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaatattttaattactcgtccttctccatatggagaacaattggtaaataaattactt
tcttttggtaaatttgcatatcatttgccattaatttacttttctacaggaaaagaatta
tgttcattggaacagaaattaaatctactttctgaaggagattttttgtgcattatatca
caacatgcaattaaatatgctcataatcagttacttaacatgggaatatcctggcctacc
aaattagcatattattccattggtcatgcgactagtgtaatgatgtacaagttatcggga
atattggtgaaatatcctacaatccaggaaactagtgaaaatttattacaattacctgaa
ctaatgtatagttatggaaagcgcgctcttattctaagaggtaataatggacgtactatt
ttagatgacactcttcaaagaagaggagtatttgttgcatcctgcgaatgttatactaga
caaccgtttcggtataatagagaaaaacaattatctaatctattaggattgaatattaga
acagtagtagttacttctggagaaatactacaacacctatattatttaattcccgaatct
tatcgcacatcttggttaatacgatgtaaattaatcgtggtaagtgtacgtctagctaaa
ttagctagacgtttaggttggacaaatattattatagcgcagtcagcaaacaacgagata
ctatttcatcttttgattaagaattcataa

DBGET integrated database retrieval system