KEGG   Candidatus Blochmannia pennsylvanicus (Camponotus pennsylvanicus): BPEN_623Help
Entry
BPEN_623          CDS       T00272                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bpn  Candidatus Blochmannia pennsylvanicus (Camponotus pennsylvanicus)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bpn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BPEN_623 (tpiA)
   01230 Biosynthesis of amino acids
    BPEN_623 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BPEN_623 (tpiA)
   00051 Fructose and mannose metabolism
    BPEN_623 (tpiA)
   00562 Inositol phosphate metabolism
    BPEN_623 (tpiA)
Enzymes [BR:bpn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BPEN_623 (tpiA)
Exosome [BR:bpn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BPEN_623 (tpiA)
  Exosomal proteins of bladder cancer cells
   BPEN_623 (tpiA)
  Exosomal proteins of melanoma cells
   BPEN_623 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
745741..746517
Genome map
AA seq 258 aa AA seqDB search
MRRLLIIGNWKLNGNKNTITNLIITLVNTFYNISKCNVAIAPPVMYLDITKRYLLNSRIQ
LCAQNVDIHLSGSFTGDISAEMLQDLNVRYALIGHSERRIHHKENDAYIAKKFFILKKVG
LIPILCVGENKREYDSGYTQSVCINQINTIITLLGIEAFKNSVIAYEPIWAIGSGASASP
ENAQLVHKSIRDYIASYDTSIADKITIQYGGSVTPENVTKFFDQKDIDGVLVGAASLNAN
SFSMIVQTAENHKKSYPA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtgagacgtctattgataataggaaactggaaattaaatggcaataaaaataccataact
aatttaattattacattagttaatacattttacaatatttctaaatgtaatgtagctata
gctccgcccgtaatgtatttagatataactaagcgttatttattgaacagtcgtattcag
ttatgtgctcaaaatgttgatattcatttatctggctcgtttacaggcgatatttcagca
gaaatgttacaagatcttaatgtacgatatgctctgataggtcattctgaacggagaata
catcataaagaaaatgatgcatatattgctaaaaaattttttatattaaaaaaagttgga
ttaattcctattttatgtgtaggggaaaataaaagagaatacgattctggatacacacag
tcagtatgcattaatcaaattaacacaatcattacgttacttggcatagaagcatttaag
aattcagttattgcttatgagcctatatgggctataggaagtggtgctagcgcatctcca
gaaaatgcgcaattagttcataaatcaatccgggattatattgcaagttatgatacatct
atagccgataaaataacgattcagtatggaggttctgtcacaccagaaaatgttactaaa
ttttttgatcaaaaagatattgatggtgtattagtaggagccgcttctttaaacgcgaat
agtttttctatgatcgtacaaactgctgaaaaccataagaaatcatatcctgcttaa

DBGET integrated database retrieval system