KEGG   Candidatus Blochmannia pennsylvanicus (Camponotus pennsylvanicus): BPEN_624Help
Entry
BPEN_624          CDS       T00272                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bpn  Candidatus Blochmannia pennsylvanicus (Camponotus pennsylvanicus)
Pathway
bpn00010  Glycolysis / Gluconeogenesis
bpn00030  Pentose phosphate pathway
bpn00051  Fructose and mannose metabolism
bpn00052  Galactose metabolism
bpn00680  Methane metabolism
bpn01100  Metabolic pathways
bpn01110  Biosynthesis of secondary metabolites
bpn01120  Microbial metabolism in diverse environments
bpn01130  Biosynthesis of antibiotics
bpn01200  Carbon metabolism
bpn01230  Biosynthesis of amino acids
bpn03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:bpn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BPEN_624 (pfkA)
   00030 Pentose phosphate pathway
    BPEN_624 (pfkA)
   00051 Fructose and mannose metabolism
    BPEN_624 (pfkA)
   00052 Galactose metabolism
    BPEN_624 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    BPEN_624 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BPEN_624 (pfkA)
Enzymes [BR:bpn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BPEN_624 (pfkA)
Protein phosphatases and associated proteins [BR:bpn01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BPEN_624 (pfkA)
Messenger RNA biogenesis [BR:bpn03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BPEN_624 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AAZ41222
UniProt: Q491Y2
Position
complement(746684..747652)
Genome map
AA seq 322 aa AA seqDB search
MFMIKKIGVLTSGGDSPGMNAAIRGVVRAGLSEGIEVYGIHDGYLGLFQDRMIQLSRRSV
SDIINRGGTFLGSARFPEFKEDATRTIVINNINQRSLDALIIIGGDGSYLGAKRLSDIGF
PCIGLPGTIDNDVAGTDYTIGYFTALETIVDAIDRLRDTSSSHQRISIVEVMGRCCGDLT
MAAAIAGGCEFIIVPEVEFNPQDLVNEIKSGISKGKKHAIVAITERICNVFYLARYIEEK
TGRETRATVLGYIQRGGKPVAYDRILASRMGAYSIDLLLKGYVGRCIGVQNEKLVHHDIN
DAIQHMQRPFRRDLLKTAKKLF
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtttatgataaaaaaaataggagtattaacaagcggaggggattctccaggaatgaat
gctgctattcgcggcgtagtacgggcaggtctttctgaaggaatagaagtgtatggaata
catgacggttatttaggattatttcaagatcgaatgatacaattgagtcgtcgtagtgtt
tcagatataataaatcgtggaggaacttttcttggttctgctcgttttcctgaatttaag
gaagatgccactaggacaatagttatcaacaatattaatcaacgtagtctcgatgctctc
ataataattggaggagatggatcttatttaggtgctaagagattgagtgatataggattt
ccttgcatcggattgcctgggactattgataacgatgttgccggaactgattacaccatc
ggttattttacagctttagaaacaattgttgatgcaattgataggttacgcgacacatct
tcttcgcatcaacgtatttctattgtagaggtaatgggacgttgttgcggtgatttgact
atggcagcagcaatagctggaggttgtgaatttattatagtccccgaagtagaatttaac
ccacaagatctagtaaacgagattaaatctggtatttctaaagggaaaaaacatgctata
gtagctatcacagaacgtatttgtaatgtattctatttagcgcgatacattgaagaaaag
actggtagagagactcgtgctacagttttaggatacatccaacgtggaggcaagcctgtt
gcatatgatcgcattctagcatctcggatgggagcatattctattgatctgctattaaag
ggttatgtagggcgctgtattggggtacaaaatgaaaaattggtacatcatgatattaat
gatgctatacaacatatgcaacgtccattccgtcgagatttattgaaaacagccaaaaaa
ctattttaa

DBGET integrated database retrieval system