KEGG   Brachyspira pilosicoli 95/1000: BP951000_0110Help
Entry
BP951000_0110     CDS       T01278                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bpo  Brachyspira pilosicoli 95/1000
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bpo00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bpo00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
118642..119721
Genome map
AA seq 359 aa AA seqDB search
MKNFIGIKEMSKEEILEVLDVAKRLDNTPNMERRKMMDGMIMTSLFFEPSTRTRLSFNSA
AYKMGLDVIGFDNPDVSSIKKGESLRDTIIMVSAYSDVIVMRHPIDGAAKFAEEVTDCPV
INAGDGSNEHPSQTLLDLYTLKDELGSIENKKIAFVGDTKYGRTVHSLSKALKMFNGEFY
YISPDIIQIPDYILKELDNAGIKYHKGNNYEEILKEIDCLYMTRIQRERFENIEDYEKVK
HAFNISKSTIVGKCKEDMIIMHPLPRVDEISIDLDDTKYAKYFIQAKNGVPTRMAMLSLA
TGIIESTAKKKEKDYELIENKEIVCQNKKCVTHFEETKNKVARRSYGDFCYYCNKEITK
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattttataggtattaaagaaatgtcaaaagaagaaattttggaagtattagat
gttgctaaaagactagataatactccaaatatggaaagaagaaaaatgatggatggaatg
ataatgacaagccttttctttgagccttcaacaagaactagactttcttttaattcggca
gcatataaaatgggtttagatgttataggttttgataaccctgatgtttcttctataaaa
aaaggagaatctttaagagacacaataataatggtttcagcatattctgatgtaatagtt
atgagacaccctatagacggtgctgctaagtttgctgaagaagttactgattgccctgta
attaatgcaggcgatggctctaatgaacaccctagtcaaacattacttgatttatacact
ttaaaagatgaattaggaagtattgaaaataaaaaaatagcatttgtaggagatactaaa
tatggaagaactgttcactctctttcaaaagctttaaaaatgtttaatggagagttttat
tatatttctcctgatattattcagattcctgattatatattaaaagaattagacaatgct
ggaataaaatatcataaaggcaataattacgaagaaatactaaaagaaattgattgttta
tatatgacaagaatacaaagagaacgttttgaaaatatagaagactacgaaaaagtaaaa
catgcattcaatatttcaaaatctacaatagtaggaaaatgcaaagaagatatgattata
atgcatccgcttcctagagttgatgagattagtattgatttagatgatacaaaatatgct
aaatattttatacaagctaaaaacggtgttcctacaagaatggctatgttatctttggct
accggtataatagaaagcactgctaagaaaaaagaaaaagattatgaattaatagaaaat
aaagaaattgtttgtcaaaataaaaaatgtgttactcattttgaagagacaaaaaataaa
gttgctagaagaagttatggagatttttgttattattgtaataaagagataacaaaatga

DBGET integrated database retrieval system