KEGG   Brachyspira pilosicoli 95/1000: BP951000_0253Help
Entry
BP951000_0253     CDS       T01278                                 

Gene name
celF
Definition
alpha-galactosidase/6-phospho-beta-glucosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
bpo  Brachyspira pilosicoli 95/1000
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bpo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BP951000_0253 (celF)
  Lipid metabolism
   00561 Glycerolipid metabolism
    BP951000_0253 (celF)
   00600 Sphingolipid metabolism
    BP951000_0253 (celF)
Enzymes [BR:bpo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     BP951000_0253 (celF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
276886..278241
Genome map
AA seq 451 aa AA seqDB search
MKFVLVGAGSAQFGCDMLGDIFSTKSLEGSHITLLDINNKALKKVYDYVREFIEANKLNF
SVDATTERKEAFKNTDFIISSIEVGDRFQLWDEDWKIPMQYGIHQVYGENGGAGGVFHSL
RIIPPILDIVKDAMDICPNAYIFNFSNPMTAICTAVKRAYPNAKFIGMCHEIGWLHKWLP
KILKKNYEDFEIKAGGLNHFSCLLEIKDKKTGKDLYPDVLKNAHSYFEHEVGYSDLLKYA
KANNAFSKTESFDHSIEEKLKGEFIWADRRLLKVILEQYKLLPITVDSHFGEYIAWAWDV
VDHRGILDFYELYRTVLSKAEPKIELRVKERASSIIDGIVTNNKYTEEAVNILNDGLIED
LPNWIAVEVPAEISKDGVKGVKLNNISKGFLSLLRNYVSVYDLTAEAAIHHKKEYAVQAI
LANPVVNVCKNTEEMLDRMIDNQKPYLDYLK
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgttttagttggtgcaggaagtgcacaatttggatgcgatatgcttggagac
attttctccacaaaatcattagaaggctctcatataactttgcttgatattaacaataag
gccttaaaaaaggtatatgattatgtaagagagtttattgaggctaacaaattgaatttt
agtgttgatgctactacagagagaaaagaggcatttaagaacactgattttattataagt
tctatagaagtgggagatagatttcaattatgggacgaagattggaaaatacctatgcaa
tatggcatacatcaagtttacggagaaaatggaggagctggaggagtatttcactctttg
agaattattccgcctattttggatatagtaaaagatgctatggacatatgtcctaatgct
tatatatttaatttttcaaaccctatgactgcaatatgtactgctgtaaaaagggcttat
cctaatgctaaattcataggcatgtgccatgagataggctggcttcataaatggcttcca
aaaatactaaaaaagaattatgaagattttgaaataaaagctggcgggcttaaccatttc
agctgtttattagagataaaagataaaaagacaggaaaagatttgtatcctgatgtattg
aaaaacgctcatagttattttgagcatgaagtaggatatagcgatttattaaaatacgct
aaagcaaataatgcattttctaaaacagagagttttgaccattctatagaagaaaaattg
aaaggtgagtttatatgggctgacagaagattattaaaagtgatattagaacaatataaa
ttattacctataacagttgacagtcattttggagaatatatagcttgggcttgggacgtt
gttgatcatagaggtatattagacttttatgaattatacagaacagttctttcaaaggct
gagcctaaaatagaattaagagtaaaagagagagcttcaagcataatagatggtatagtt
acaaacaataaatacacagaagaagctgtaaatattttgaatgacggattaatagaagat
ttgcctaattggatagcagttgaagtacctgctgaaataagcaaagatggagttaagggc
gttaaattaaacaatatatctaaaggatttttatctcttctaagaaactatgtgagtgta
tatgatttaactgctgaggctgctatacatcataaaaaagaatatgcagtgcaggctata
cttgctaatcctgtagttaatgtatgtaaaaatacagaggaaatgctagatagaatgata
gataatcaaaagccatatttagattatttaaaataa

DBGET integrated database retrieval system