KEGG   Brachyspira pilosicoli 95/1000: BP951000_0276Help
Entry
BP951000_0276     CDS       T01278                                 

Gene name
gla
Definition
(GenBank) alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
bpo  Brachyspira pilosicoli 95/1000
Pathway
bpo00052  Galactose metabolism
bpo00561  Glycerolipid metabolism
bpo00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bpo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BP951000_0276 (gla)
  Lipid metabolism
   00561 Glycerolipid metabolism
    BP951000_0276 (gla)
   00600 Sphingolipid metabolism
    BP951000_0276 (gla)
Enzymes [BR:bpo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     BP951000_0276 (gla)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_36N Glyco_hydro_36C GHL10 TMEM131_like GHL15
Motif
Other DBs
NCBI-ProteinID: ADK30283
UniProt: D8IAV2
Position
complement(306341..308458)
Genome map
AA seq 705 aa AA seqDB search
MVHEDNYVFMPYWGAKIEASNIDYIIDEITEANYMAYTDNRKKFQLEVIPQIYPSYGYTD
LKEPAFHFLHKDGSRITDLRYKLHNIYKTKKKLEGLPTVLSDEHSEVLELVLFDELKKIE
VTITLAVFEKYNAITKSVKVINKHETDSLYIEKIMSANIDLQESNFELLHLSGAWGRECH
IKRRKLEQGMQSIGSVRGASGHGQNPFAALISPNADENNGEVYAMNFVYSGNFKASVEVD
MHLNTRFQMGINDFDFGWTLMPNEEFQTPEAVLVYTNKGLGDMSRTFHKLYQDCLMSKKY
AYKERPILINSWESNYFDFNKESLLKLAKEAKNIGAELFVLDDGWFGKRDDDKSSLGDWI
PNEKKLGGSLSALIDDINKTGLSFGLWFEPEMVSPDSDLFRKHPEWAIQVKGRKIETSRY
QYVLDLSNPEVCGYIINFMTDILSKNNISYVKWDMNRNITNLGSSYLKPEKQKEQSHRYM
LGLYSVLENIVNAFPNILFESCAGGGGRCDAGMLYYMPQVWTSDDTDAIERLAIQYGASL
IYPSISLACHISDIPNHQTHRKETIETRANVAMWGNLGLELNLNKISEEDKKNISEKLEV
YKLIRSTVQFGSLYRLKGLDYGNEYAWLHKSIDEKTIVVNYVQINMVPNLLTKRLRLEAL
EPKSKYKVNDSDKIYTGEELMNIGLVLGEIVEDAIAIQWIIKKID
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atggttcatgaagataattatgtatttatgccttattggggggcaaaaatagaggcaagc
aatatagattatattattgatgaaataactgaagctaattatatggcatatactgataat
agaaaaaaatttcagcttgaagtaatacctcaaatatatccttcttacggttacacagat
ttaaaagaaccagcatttcattttctacataaagacggttcaagaataacagacttgcgt
tataaattacataacatatataaaactaaaaagaaattagaaggacttcctacagtgtta
tcagatgagcatagtgaagtattagaattagttttatttgatgagttgaaaaaaattgag
gtaacaattactttagctgtatttgaaaaatataatgcaataacaaaatcagtaaaagta
ataaataaacatgaaacagattctttatacatagaaaaaataatgtcagcaaatatagac
cttcaggaatcaaattttgaattgcttcatttgtctggtgcttggggaagagaatgtcat
attaagagaaggaaattagagcagggaatgcagtctataggaagtgtgagaggtgcatca
ggacatggtcaaaacccatttgctgctttaatatctcctaatgctgatgaaaataatggg
gaagtatatgctatgaatttcgtatacagcggaaattttaaagcaagtgttgaagtggac
atgcatttaaatactagatttcaaatgggaataaatgattttgattttggttggacatta
atgcctaatgaagagtttcaaactcctgaagctgtgcttgtatatacaaacaaaggttta
ggtgatatgtcgagaactttccataaactttatcaagattgtttgatgtcaaaaaaatat
gcttataaagagcgtcctattttgataaacagttgggaatccaattattttgattttaat
aaagaaagtcttttaaaattagctaaagaggcaaaaaatataggagctgaattatttgta
ttagatgatggttggtttggaaaaagagatgatgataaaagttctttgggagattggata
cctaatgaaaaaaaacttggcggaagtttgtctgctttgatagatgatataaataaaact
ggattaagttttggattatggtttgaacctgaaatggtatctcctgatagtgatttattt
agaaaacacccagagtgggctattcaagttaaaggcagaaaaatagagacttcaagatat
cagtatgtattagatttaagtaatcctgaagtatgcggctatataataaactttatgact
gatattttatcaaaaaataatatttcttatgttaaatgggatatgaatagaaatattaca
aatttaggttcatcttatctaaaacctgaaaagcaaaaggaacaatctcatagatatatg
ttaggtctttacagtgtattagaaaatattgttaatgcatttcctaatatattatttgaa
agctgtgcaggaggcggcggaagatgtgatgctggtatgctttattatatgcctcaggtt
tggacaagtgatgatactgatgctatagaaagacttgctatacaatatggagcttcttta
atttatccttcaatatctttagcttgccatatttctgatatacctaatcatcaaacacat
agaaaggaaactatagaaacaagagcaaatgttgctatgtgggggaatttgggattagaa
ttaaacttaaataaaataagtgaagaagataaaaaaaatatatcagaaaaattggaagtt
tataaactcataagaagtactgttcagtttggaagtctttacagattaaaaggtttagat
tatggtaatgaatatgcttggcttcataagagtattgatgaaaaaactatagttgtaaat
tatgtgcaaataaatatggttcctaatttattaacaaagcgtttgcgtttagaggcatta
gagcctaaaagtaaatataaagtaaatgactctgataaaatctacactggagaagagtta
atgaatattgggcttgtgcttggagagatagtggaagatgctatagctattcaatggata
ataaaaaagattgattaa

DBGET integrated database retrieval system