KEGG   Brachyspira pilosicoli 95/1000: BP951000_0315Help
Entry
BP951000_0315     CDS       T01278                                 

Gene name
pncA
Definition
bifunctional pyrazinamidase nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
bpo  Brachyspira pilosicoli 95/1000
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:bpo00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
356596..357237
Genome map
AA seq 213 aa AA seqDB search
MSKVKILTIVDMQNDYMEGGPMAVNGAIGLIPVINDLIKNGEYDAIIATQDWHPSNHISF
ASTHNKEPFSKIRVMDQETGDEDILTLWPRHCVARTFGSAIVDELKKKKDYIYVQKGVDA
DDEGVSGFSYMHKDFIDAARENKEVLILDFVGVALDYAVYYTARDTAQYVTSINAEYLVS
VNVLEYATAAMNPDKVYELYSNTKNINLKKVHL
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaggttaagatactaacaatagtagatatgcaaaatgattatatggaaggcggt
cctatggctgttaatggagcaattggacttatacctgtaattaatgaccttataaaaaat
ggagaatatgatgctataatagctactcaagattggcatccatcaaatcatatatctttt
gcttctactcataataaagaacctttttctaaaattagagtaatggaccaagaaactggc
gatgaagatattttaacactttggcctcgtcattgtgttgctagaactttcggctctgct
attgttgatgaattaaaaaagaaaaaagattatatttatgttcaaaagggtgttgatgct
gatgatgagggagtatctggattttcttatatgcataaggactttatagatgctgctaga
gaaaataaagaagtattgatattagattttgtcggtgttgctttggattatgctgtttat
tatacggcaagggatacagctcaatatgtaacttctattaatgctgaatatttagttagc
gtaaatgttttagaatatgcaactgctgcaatgaatccagataaagtctatgaattatat
tccaatacaaaaaacattaatcttaaaaaggttcatctgtga

DBGET integrated database retrieval system