KEGG   Brachyspira pilosicoli 95/1000: BP951000_0325Help
Entry
BP951000_0325     CDS       T01278                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bpo  Brachyspira pilosicoli 95/1000
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bpo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BP951000_0325 (recR)
DNA repair and recombination proteins [BR:bpo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BP951000_0325 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(364622..365230)
Genome map
AA seq 202 aa AA seqDB search
MSGIDSLDKLTQMIARLPGIGGRSAMRIALYLFDSDDEYLSELSNSILSLHKNIKLCREC
YSLSENDICNICASDKRDRTKLCIVESYTDMIAIEKTEEYNGIYHVLGGLIEPLKGIGIS
DIRIKELIDRVKDNSSIEEIIIAFGASLEADTTASYINKTLRNNNFDKKISRITYGISLA
SDIENADSRSLARSIADRVVMQ
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
ttgagcggtattgattctttagataagcttacacagatgatagctagacttcctggaata
gggggaaggagtgctatgcgtattgctttgtatttgtttgacagtgatgatgaatattta
agcgagttatctaattctattttgtcgctgcataaaaatataaagctttgcagagaatgt
tattctttgagtgagaatgacatttgcaatatatgtgcaagtgataaaagagacagaaca
aagctatgcatagttgaatcttatacagatatgattgccatagaaaaaacagaagaatac
aatggtatttatcatgttttaggaggattaatagagcctcttaaaggaataggtatttca
gatataagaataaaagaattaatagatagagttaaagataatagctcaatagaagaaatt
attatagcatttggtgcttcattagaggcagatactacagcatcgtatataaataaaact
ttgagaaacaataatttcgataaaaaaataagccgcattacatatggtatatcattagca
agcgatattgaaaatgctgattcacgttcattagcaagaagcattgcagacagagtagtt
atgcagtag

DBGET integrated database retrieval system