KEGG   Brachyspira pilosicoli 95/1000: BP951000_0628Help
Entry
BP951000_0628     CDS       T01278                                 

Definition
putative anhydromuramoyl-peptide exo-beta-N-acetylglucosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bpo  Brachyspira pilosicoli 95/1000
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpo00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BP951000_0628
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    BP951000_0628
Enzymes [BR:bpo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BP951000_0628
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(697429..698463)
Genome map
AA seq 344 aa AA seqDB search
MIIGLLINSCTKKDSITEDEKYILELKKKYSYLSNYIDEVNSMSIEERRGLLTMVGITDT
VLSKETIKTLKDNHVSGIILFNYNIVDEEQLKKLTSDLKKYVNKNMLISIDEEGGEVFRI
PFDKYKDISAKMIGDSNSIEYAYNIAYNKAKFLKDMGINMILGPLCDVPSNKDSYIYNRS
FSTNVEMVSKMVEATIKAQKDAGIISVVKHFPGHGDTSVNSHSEFPIIDKTLEELKNKEL
IPFQKAIDLGAEMVLVSHIKNKYIDDTLPASMSEKYRKLLEEDMGFKGVIITDDLVMTGK
IDSTINYGINLTSNIYKNVKEMFRNIEPDIISCAKVLKIMRENT
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgattattggcttacttattaattcttgcacaaaaaaagacagcatcacagaagatgaa
aaatatattttggaattgaaaaaaaaatattcttatttgtctaactatatagatgaagtt
aatagtatgagcattgaagagaggagaggacttcttactatggtgggcatcactgacaca
gtattaagcaaagagaccataaagacactaaaagataatcatgtttctggtattatactt
tttaattacaacatagtagacgaggaacaattaaaaaaactcacatcagacttaaagaaa
tatgttaacaaaaatatgttaatttctatagacgaagaaggaggcgaagtctttagaata
cctttcgacaaatacaaagacatttcagccaaaatgataggcgacagcaacagcattgaa
tatgcatacaacatagcatataacaaagcaaagtttctaaaagatatgggtattaatatg
atacttggtccgttatgcgatgtgccaagcaacaaagattcttatatatacaatagaagc
ttttctacaaatgttgagatggtttcaaagatggtggaagctacaataaaagctcagaaa
gatgccggtattataagcgttgttaagcattttcctggtcatggggacacttctgttaat
tcgcatagtgagtttcctattatagataaaactttagaggagcttaaaaataaagaatta
ataccttttcaaaaggctatagatttgggtgctgagatggttttagtttcgcatataaaa
aataaatatatagatgatacacttcctgccagcatgtcagaaaagtatagaaagttactt
gaggaagatatgggttttaaaggggtgattattacagatgacctcgttatgacaggaaag
attgatagcactatcaattacggcataaatcttacaagcaatatttataagaatgtaaaa
gagatgtttagaaatatagaaccagatataatttcatgtgctaaggtattaaagataatg
agagaaaatacctaa

DBGET integrated database retrieval system