KEGG   Brachyspira pilosicoli 95/1000: BP951000_0658Help
Entry
BP951000_0658     CDS       T01278                                 

Gene name
tpiA
Definition
(RefSeq) triose-phosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bpo  Brachyspira pilosicoli 95/1000
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bpo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BP951000_0658 (tpiA)
   01230 Biosynthesis of amino acids
    BP951000_0658 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BP951000_0658 (tpiA)
   00051 Fructose and mannose metabolism
    BP951000_0658 (tpiA)
   00562 Inositol phosphate metabolism
    BP951000_0658 (tpiA)
Enzymes [BR:bpo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BP951000_0658 (tpiA)
Exosome [BR:bpo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BP951000_0658 (tpiA)
  Exosomal proteins of bladder cancer cells
   BP951000_0658 (tpiA)
  Exosomal proteins of melanoma cells
   BP951000_0658 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(735930..736688)
Genome map
AA seq 252 aa AA seqDB search
MRRKLIAGNWKMNNTNKEALELVNQLKDLVKDVKDRDIMIAPTFTCLSDVNNAIKGSNIK
LGAQNLYFEEKGAFTGQISADMLLSVGCEYVIVGHSECRDIFGEKDELINKKVKRALDKN
LVPVLCVGEHLEEREKGITSDIVSSQVKEAFKGLSEAEAKKVVIAYEPVWAIGTGKTATP
QDADDVHKTIRDTLKSIYNESVSEGMIILYGGSVNEKNADDLLNMPNIDGALVGGASLVA
DKFARIVNYIAK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagaagaaaacttatagctggtaactggaaaatgaataatactaacaaagaggctttg
gagttagtaaatcagttaaaagatttagtaaaagatgttaaagacagagacattatgata
gcacctacttttacttgcttgagcgatgttaataatgctattaaaggaagcaatataaaa
ttaggagcacaaaatttatattttgaagagaagggtgcttttactggtcagatttctgct
gatatgcttttgtctgtaggctgtgaatatgttatagttggtcactctgaatgccgtgat
atatttggtgaaaaagatgagcttataaacaaaaaagtaaaaagagctttagataaaaac
ttagtacctgttttatgtgtaggcgaacatttagaagagagagaaaaaggcattacttct
gatatagtaagcagtcaagtaaaagaggctttcaagggtttaagtgaagctgaggctaaa
aaggttgtaatagcttatgaacctgtttgggctattggtactggtaaaactgctactcct
caagatgctgatgatgtacataaaactataagagacacattaaagtctatttataatgag
agtgtttctgaaggcatgattatactttacggcggaagcgttaatgagaaaaatgctgat
gatttgcttaatatgcctaatatagatggtgctttagttggcggtgcttcattagttgct
gacaagttcgctagaatagttaattatatagctaagtaa

DBGET integrated database retrieval system