KEGG   Brachyspira pilosicoli 95/1000: BP951000_0683Help
Entry
BP951000_0683     CDS       T01278                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bpo  Brachyspira pilosicoli 95/1000
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bpo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BP951000_0683 (ruvA)
Enzymes [BR:bpo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BP951000_0683 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
759013..759597
Genome map
AA seq 194 aa AA seqDB search
MFAFIEGKVCTISEGIIALLCSNGVAYEIIVSKKLNVNNDDNIRLYTQLIHKEDSMTLYG
FKTREEKKMFNTLMSASGVGAKLAMEVLSTYSIDEIMHILFNKDINMLKKVQGMGVKKAE
KLLFEIRDKIEKIDINISSSKISYNENESDVIKALISLGFSNNEAVKALSNIENKENKTT
EDLISLALRNLSSI
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcttttatagaaggtaaagtttgcacaatatcagagggaatcattgctctttta
tgttctaatggggtcgcttacgagattatagtatcaaaaaaattaaatgttaataatgat
gataatataagactatacactcaattaatacataaagaagattctatgacgctttatggt
tttaaaacaagagaagagaaaaagatgtttaatactttaatgtctgcctctggtgttggg
gcaaaacttgcaatggaagttctatccacatattcaatagatgaaataatgcatatactc
tttaataaagatattaatatgcttaaaaaagttcagggaatgggcgtaaaaaaggctgaa
aaacttttgtttgaaattagagataaaatagaaaagatagacataaatatttcttcttct
aaaatatcatataatgaaaatgaaagcgatgtaataaaagctcttatatcattaggcttt
tcaaataatgaagctgtaaaagcattatcaaacatagaaaataaagaaaataaaacaaca
gaagatttaattagcttagcattaagaaacttaagcagcatataa

DBGET integrated database retrieval system