KEGG   Brachyspira pilosicoli 95/1000: BP951000_0693Help
Entry
BP951000_0693     CDS       T01278                                 

Gene name
alp
Definition
alkaline protease Alp
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bpo  Brachyspira pilosicoli 95/1000
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:bpo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BP951000_0693 (alp)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BP951000_0693 (alp)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BP951000_0693 (alp)
Enzymes [BR:bpo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BP951000_0693 (alp)
Exosome [BR:bpo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BP951000_0693 (alp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(769596..771185)
Genome map
AA seq 529 aa AA seqDB search
MIQLLPILLLSAFFIGCGQQPYTNLENTPKAKNVIVLIADGQSSDVITYSRWFKGGDSLA
IDEMLSGAVRTHNADSPIADSAPAGTALATGYKSSYQQFIGILPDEAILPNSSIPTEARA
PIANVLEAAQLIGKSTGVISTSEIMHATPAAFSAHDITRKDYDDLSEQQVFQDIDVILGG
GYKFFTKEARKDGKDLISEITNLGYSLIRTSDELDSFRGDKVVGLFADADLAYEIDREET
TQPSLAQMTSKAIDILSKNDKGFFLIVEASKVDWAAHANDPVGLVSDTLAYVDAVKAALD
FAKKDNNTMVIAVTDHGNSGFTMGNYDTSSDYHKRTLESFIEPVKKASRSAEYVARKIEA
GEDIKTAMQKYYAIDDMTEEEVNSLRGKTGDDLHYAIGPILAKRAYLGFSTHGHTGEDVP
LYTYLPNNKRIIGLIDNTDIAKNIASAMEINLDEATKKLFMSEDELKKAGVELTSDGNIL
TMHIGDKTAQIMKNRNIIIVNGEKKTLDGVVVYNESKWYFPSQVLDILK
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgattcaattattacctattcttcttttatccgcattttttatcggatgcggtcaacag
ccttacactaatttagaaaataccccaaaagctaaaaacgttatagtactaattgcagac
ggacaaagctctgatgtaatcacatactcaagatggtttaaaggcggcgattcattagca
atagatgagatgttaagcggagcagtgagaactcataatgctgattctcctatagccgat
tcagcacctgcaggtacagctttagctacaggctataaatcatcttatcagcagtttata
ggtatacttccagatgaagctatacttcctaattcatcaatacctacagaagcaagagcc
cctatagcaaatgtgttggaggcagctcagcttattggcaaatctacaggagtaatttct
acttcagaaattatgcatgccactcctgcagctttttctgctcatgacatcactagaaaa
gattatgacgacttaagcgaacagcaagtgtttcaagatatagatgttatattaggagga
gggtataagttttttactaaagaggctagaaaagacggaaaagatctaatatcagaaata
actaatttaggctattctctaattagaacttcagatgaattggattcttttagaggtgat
aaagttgtaggactttttgctgatgcagatttagcttatgagatagacagagaagagaca
actcagccatcattagctcaaatgacttcaaaggctatagatatactttctaaaaatgac
aaaggtttcttcttgattgtagaggcttcaaaagttgactgggcagctcatgctaatgac
cctgttggattagtttctgatactttggcttatgttgatgctgtaaaagcggcattagat
tttgctaaaaaagataataatactatggttatagctgtaactgaccatggaaacagcggt
tttactatgggtaattatgatacttcttcagattatcacaaaagaacattagaaagtttt
atagagcctgtaaaaaaagcttctcgttctgctgagtatgttgcaagaaaaatagaagct
ggagaagatataaaaacagctatgcaaaaatattatgctatagatgatatgacagaagaa
gaggttaattctcttagaggaaaaacaggcgatgatttacattatgctataggaccaata
ttagcaaaaagagcttatttaggtttcagcacacatggtcatactggagaagatgttcct
ctatatacatatttgccaaacaacaaaagaattataggacttatagataatactgatata
gctaaaaatattgcctctgctatggaaataaatttagatgaagctacaaaaaaattattt
atgagtgaagatgaattaaagaaggcaggtgtagaattaacatcagacggtaatatactt
actatgcatattggagataaaactgctcaaataatgaaaaatagaaatataataattgta
aatggagagaaaaaaactttagacggtgtagttgtttacaatgaatctaaatggtatttc
ccttctcaggttttagatatattaaaataa

DBGET integrated database retrieval system