KEGG   Brachyspira pilosicoli 95/1000: BP951000_0786Help
Entry
BP951000_0786     CDS       T01278                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
bpo  Brachyspira pilosicoli 95/1000
Pathway
bpo00010  Glycolysis / Gluconeogenesis
bpo00071  Fatty acid degradation
bpo00350  Tyrosine metabolism
bpo00625  Chloroalkane and chloroalkene degradation
bpo00626  Naphthalene degradation
bpo01100  Metabolic pathways
bpo01110  Biosynthesis of secondary metabolites
bpo01120  Microbial metabolism in diverse environments
bpo01130  Biosynthesis of antibiotics
bpo01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bpo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BP951000_0786
  Lipid metabolism
   00071 Fatty acid degradation
    BP951000_0786
  Amino acid metabolism
   00350 Tyrosine metabolism
    BP951000_0786
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BP951000_0786
   00626 Naphthalene degradation
    BP951000_0786
Enzymes [BR:bpo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BP951000_0786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 Borrelia_REV
Motif
Other DBs
NCBI-ProteinID: ADK30784
UniProt: D8ICB1
Position
complement(875275..876435)
Genome map
AA seq 386 aa AA seqDB search
MDFNFYMPSKVIFGTGSLNKLHKQKLPGKKALIVTGGTSIKKYGYLNRLEEELKKANVSY
VLFDKILPNPIKDHVMEGAALAKKENCDFVIGIGGGSSIDSSKSIAVMAANDGDYWDYIF
GGTGKGKAVPNDPLPVVAITTTAGTGTEADPWTVITNGNEKIGFGYEKTYPYLSIVDPEL
MKTVPPKLTAYQGFDALFHSTEGYINKIASDMSDLFALKAIELIGKSLADAVKDGNNMKA
REDVAMANTLSGIVESTSSCTSEHSMEHALSAYYPKLEHGAGLIIISKEYYTTIANAHDC
DEKMVNMAKALGKKDASKAMDFVEALVDLQKACGVDNLKLSDYGISKDDLPKIAKNARFA
MGGLFECDPHNFTDEEVLTILEKSYR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggattttaatttttatatgccaagtaaagttatattcggtacaggttctctaaataaa
ctgcataaacaaaagcttccgggcaaaaaagcattaattgttacaggcggtacttctata
aagaaatatggttatttaaatagattagaagaagaattaaaaaaagcaaatgtaagctat
gttttatttgacaaaattttaccaaatccaataaaagaccatgtaatggaaggggctgct
ttggcaaaaaaagaaaattgtgattttgtaataggtataggcggaggaagcagtattgac
tcttcaaaatctattgctgtaatggctgctaatgacggagattattgggattatatattc
ggcggtactggtaaaggtaaagcagttccaaatgaccctcttccagtggtagcaataaca
acaacagcaggcacaggtacagaggctgacccttggactgtaattactaatggaaatgaa
aaaataggttttggttatgagaaaacttatccttatctttctatagtagacccagaactc
atgaaaacagttcctcctaaacttactgcttatcagggttttgatgcgttgtttcatagt
acagaaggatatattaataaaattgcaagcgatatgagtgatttgtttgctttaaaagca
atagagcttataggcaaaagtttggctgatgctgttaaagatggaaacaacatgaaggca
agagaagatgttgctatggctaatactttatctggaatagttgaaagtacttcaagctgt
acatcagaacattctatggagcatgctttaagtgcttattatccaaagcttgagcatggt
gctggtcttattataataagtaaagaatattatactacaatagcaaatgctcatgattgc
gatgaaaaaatggttaatatggctaaggctttaggtaaaaaagatgcctctaaggctatg
gattttgtagaagctttggttgatttacagaaggcttgcggtgtagataatctaaaactt
tccgattatggtattagcaaagatgacttgccaaaaatagctaaaaatgctagatttgct
atgggcggattgtttgaatgtgatcctcataactttacagatgaagaagtattaactata
ttagaaaaatcttatagataa

DBGET integrated database retrieval system