KEGG   Brachyspira pilosicoli 95/1000: BP951000_0800Help
Entry
BP951000_0800     CDS       T01278                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bpo  Brachyspira pilosicoli 95/1000
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpo00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    BP951000_0800 (glpK)
Enzymes [BR:bpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     BP951000_0800 (glpK)
Exosome [BR:bpo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BP951000_0800 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
893888..895372
Genome map
AA seq 494 aa AA seqDB search
MSKYVVAIDQGTTSSRAIVFDYEQNMVSVAQKEFTQIYPHEGWVEHNASEIWATQFGVLQ
EAIQIAGVKPEEIAAIGITNQRETTVVWDKNTGEPIYNAIVWQCRRTAPICDELKKKGLD
TYIRENTGLVVDAYFSGTKIKWILDNVPGAREKANKGELLFGTIDTWLVWKLTGGKVHVT
DYTNASRTMIYNIKDLKWDENILRELDIPISMLPEVKDSSCVYGYANINGKEVPIAGIAG
DQQSALFGQAGFNKGDTKNTYGTGSFILMNIGENFILSKNGLITTIGIGYKGKIEYALEG
SVFIAGAVIQWVRDELRLLHDAKDTEYFATKVKDTNGVYLVPAFVGLGAPYWDMYARGCL
VGITRGVNRSHIIRAAEEAIAYQSKDVIDAMVADSKVKLSSLKVDGGACRDNFLMQFQAD
IIHTKVLRPQITETTALGAAYLAGLAVGFWKDKDEISNKWKLEREFTPSLSEEESNKKYM
GWKKAVERAKGWAL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaatatgtagttgcgatagaccaaggaaccactagcagcagagcaatagtattt
gattatgaacaaaacatggtatcagttgctcaaaaagagtttacacaaatttatccgcat
gaaggctgggttgaacataatgcttctgaaatatgggctacacagtttggggtattacag
gaagctatacaaattgcaggagtaaaaccagaagaaatagctgcaattggcatcactaat
caaagagaaactacagttgtttgggataagaacacaggagagcctatttataatgctata
gtttggcaatgcagaagaactgctcctatttgtgatgaacttaagaaaaaaggtcttgat
acatatataagagaaaatacaggattggttgttgatgcttatttctcaggcactaaaatt
aaatggatacttgataatgttcctggtgctagagagaaggctaataaaggtgaattatta
ttcggtacaatagacacttggctagtatggaaacttacaggcggaaaggtgcatgttaca
gattatactaatgcctcaaggactatgatatataacataaaagacttaaaatgggacgag
aatattttaagagaattagatatacctattagtatgcttccagaagtaaaagactcttca
tgcgtttacggatatgctaatattaacggaaaagaagttcctatagcaggaatagcagga
gaccaacaatctgcattattcggacaggctggatttaataagggagatacaaaaaatact
tatggtacaggaagttttattttaatgaatattggagaaaacttcattttaagtaaaaat
ggactaatcaccactataggaattggatataaaggaaaaattgaatatgctttggaaggt
tctgtatttatagctggtgctgttatacagtgggtacgtgatgaattaagacttcttcat
gatgcaaaagacactgaatattttgctaccaaagtaaaagatacaaacggagtttatttg
gtgcctgcatttgttgggcttggtgctccttactgggacatgtatgctaggggttgtttg
gttggtattacaaggggtgttaatagaagccatataataagagctgcagaagaggctatt
gcttatcaaagtaaagatgtaattgatgctatggtagcagacagtaaagtaaaactctct
tcattaaaggtagacggtggcgcttgcagagataatttcttgatgcagtttcaagcagat
attattcacacaaaagtgcttcgtcctcaaattacagaaactactgctttgggtgctgct
tatttggcaggtcttgctgtaggattctggaaagataaagatgaaatatctaataagtgg
aaattagaaagagagtttactccttcactttctgaagaggaaagcaataaaaaatatatg
ggctggaaaaaggctgttgaaagagctaaaggctgggctttataa

DBGET integrated database retrieval system