KEGG   Brachyspira pilosicoli 95/1000: BP951000_0897Help
Entry
BP951000_0897     CDS       T01278                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bpo  Brachyspira pilosicoli 95/1000
Pathway
bpo00010  Glycolysis / Gluconeogenesis
bpo00030  Pentose phosphate pathway
bpo00051  Fructose and mannose metabolism
bpo00052  Galactose metabolism
bpo00680  Methane metabolism
bpo01100  Metabolic pathways
bpo01110  Biosynthesis of secondary metabolites
bpo01120  Microbial metabolism in diverse environments
bpo01130  Biosynthesis of antibiotics
bpo01200  Carbon metabolism
bpo01230  Biosynthesis of amino acids
bpo03018  RNA degradation
Module
bpo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bpo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BP951000_0897 (pfkA)
   00030 Pentose phosphate pathway
    BP951000_0897 (pfkA)
   00051 Fructose and mannose metabolism
    BP951000_0897 (pfkA)
   00052 Galactose metabolism
    BP951000_0897 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    BP951000_0897 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BP951000_0897 (pfkA)
Enzymes [BR:bpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BP951000_0897 (pfkA)
Protein phosphatases and associated proteins [BR:bpo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BP951000_0897 (pfkA)
Messenger RNA biogenesis [BR:bpo03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BP951000_0897 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat AP_endonuc_2 Radical_SAM
Motif
Other DBs
NCBI-ProteinID: ADK30895
UniProt: D8ICM2
Position
complement(1007499..1008479)
Genome map
AA seq 326 aa AA seqDB search
MADIKKIGVLTSGGDASGMNPTIRSVVRTAIANGLEVVGIREGYQGLMYNNVYKMDAGSV
GGIINHGGTILFSARSPEFQTEEGMKKAADNMKYNGIDALVVIGGDGTYKGALDFANHHE
EFPVIGIPGTIDNDIFGTDYTIGYDTAVNVAMEAIDKLRDTATSHGRCFVVEVMGRHAGY
IALEVGIASGAEDILIPETTTDIDKIVENLQIAKKRGKKSSIIVVAEGDESGGAMEVAKQ
IEGKTGFDTRVTILGHMQRGGSPTSRERLMAARFGYIAVKALLEGKRNVAVGIWKGEYTY
TPLADAVKKVPKVDPIDLELCRTLAI
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggctgatataaagaaaataggagtattaacaagtggaggagatgcttcaggaatgaac
cctactataagaagcgttgttagaacagctatagctaatggtttagaggtagttggaata
agagaggggtatcagggtttaatgtataataatgtttataaaatggatgctggttctgtt
ggcggcattattaatcatggcggtacaattttgttttctgcaaggtctccagagtttcaa
actgaagaaggaatgaaaaaagcagctgataatatgaaatataacggaatagatgcttta
gttgttataggcggtgatggtacttataaaggagcattagattttgctaatcatcatgaa
gagtttcctgttattggtatacctggtactatagataatgatatatttggtactgattat
actataggatatgatacagctgtaaacgttgcaatggaggctatagacaaattaagagat
actgctactagccacggaagatgttttgtagttgaggttatgggaagacatgctggttat
attgctttagaagttggtatagcttctggtgctgaagacatacttattccagaaactact
actgatattgacaaaatagtagaaaacttacaaatagcaaaaaagagaggtaaaaaatct
tctataatagtggttgctgagggagatgagtctggcggagctatggaggtagctaaacaa
atagaaggtaaaacaggttttgatactcgtgttactatacttggacacatgcaaagaggc
ggttctcctacttctcgtgaacgtcttatggctgcaagatttggttatattgcagttaag
gcattattagaaggtaagagaaatgttgctgttggtatatggaaaggtgaatatacttac
actcctttggctgatgctgttaaaaaagttcctaaagttgatcctatagatttagagttg
tgcagaactcttgctatataa

DBGET integrated database retrieval system