KEGG   Brachyspira pilosicoli 95/1000: BP951000_0935Help
Entry
BP951000_0935     CDS       T01278                                 

Definition
(GenBank) pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductase alpha subunit-like protein
  KO
K00169  
pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
bpo  Brachyspira pilosicoli 95/1000
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bpo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BP951000_0935
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BP951000_0935
   00020 Citrate cycle (TCA cycle)
    BP951000_0935
   00620 Pyruvate metabolism
    BP951000_0935
   00640 Propanoate metabolism
    BP951000_0935
   00650 Butanoate metabolism
    BP951000_0935
  Energy metabolism
   00680 Methane metabolism
    BP951000_0935
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    BP951000_0935
Enzymes [BR:bpo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     BP951000_0935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1044781..1047045)
Genome map
AA seq 754 aa AA seqDB search
MAQKYNLAEQENILESGNELAAIAAAQINYHVMGYYPITPSTQIAEYLDEMKANGRHTVC
MIPGDGEHGAAGICYGATTAGGRVFNATSANGLLFAMEQLPVQAGTRFPMVLNVVNRTVS
GPLDIKCDQSDIMMALNTGWIIIMAHTTQMVYDFNIFALKIAEKAKLPIIVSSDGFFTSH
QKKKIHLFKNDKDVQDFLGKYTPEVTSVEPTKNPVTIGPYMNEDELTGSKLQLSQALEDS
RAIIAEVFEEFASLSGRKYSPIETHNMEGAEVALMLCGSAYETGTLAVDEMRKANPNLKI
GAFAITQIRPFPEKELQKLLANVKVVVVGDRQDTYSGMGGNMSTEIRAALKNDPNNKSSI
VSRVYGLGGTEFTLDKAKELFELGLKELAKAGSVEKHSYLEQYMGDPNVKMKPIHEPLTL
ESQKSGITVTMNEQTHKLDVKVPPLRELTGKAYRYAQGHGACNGCGIFSGINTFMKGIEG
SVVLLVHTGCSMVVTTGYPYSSYRTTYVHNLFQNGAATLSGIVEMYHERKRRGEIDGPED
PTFIMVTGDGGHDIGMGPSIGAAIRNHKMIILEYDNEGYMNTGNQLSFSTPLGHRTSTSN
VGKAEVGKQFGHKDVAQIFNGCHIPYIATGCEAYPLDLVKKAAKAQWYANNVGTAFVKLL
ITCPLNWKTPDDMGKDIIKAAVDCCFFPLYEVEQGITTITNMVADDKKQPVTEWLKLMGK
TKHLLKHQDILDKFQADVDNRWARLKAMHESPVL
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaaaatataatcttgctgagcaagaaaacatacttgaaagtggtaatgaatta
gcagccattgcagccgctcaaatcaattatcacgttatgggttactacccaatcactcca
tctactcaaattgctgagtacttagatgaaatgaaagctaatggcagacatactgtttgc
atgattcctggtgacggtgaacatggtgcagctggtatctgttatggtgctactactgca
ggaggaagagtattcaatgctacttctgctaacggtttactttttgctatggaacaatta
cctgttcaagctggtactagattccctatggtattaaacgttgtaaacagaactgtttct
ggtccattagatattaaatgtgaccaatctgacataatgatggctcttaacactggttgg
attatcattatggctcatactactcagatggtttatgacttcaatatatttgcattaaaa
attgctgagaaagctaaacttcctatcattgtttcttctgacggattctttacttctcac
caaaagaaaaaaatccaccttttcaaaaatgataaagatgttcaagatttcttaggtaaa
tatactcctgaagttacttctgttgagcctactaagaaccctgttactattgggccttac
atgaatgaagacgaattaacaggtagtaaattacaactttctcaagctttagaagattct
agagctattattgctgaagtatttgaagagtttgcttctctttctggaagaaaatactct
cctatagaaactcataacatggaaggagctgaagttgctttaatgctttgcggttctgct
tatgaaactggtactttagctgttgatgaaatgagaaaagctaatcctaatcttaaaatt
ggtgctttcgctattactcagattcgtcctttccctgaaaaagaattacaaaaattactt
gctaatgttaaagtagttgttgtaggtgatagacaagatacttattctggtatgggcggt
aatatgtctactgagattagagctgctcttaaaaatgaccctaacaacaaatcttctatt
gttagcagagtttatggtcttggcggtactgagtttactcttgacaaagctaaagaatta
tttgaattaggtttaaaagaattagctaaagctggttctgttgaaaaacactcttattta
gaacaatatatgggtgaccctaatgttaaaatgaaacctatacatgaacctttaacttta
gagagccaaaaatcaggtatcactgttactatgaacgaacaaactcataaacttgatgtt
aaagttccacctcttagagaattaactggtaaagcttatcgttatgctcaaggtcatggt
gcttgtaacggttgtggtatattctctggtatcaatactttcatgaaaggtatagaaggt
tctgttgtacttttggtacatactggttgttctatggttgttactactggttatccttac
agctcttatagaactacttatgttcacaacttgttccaaaacggtgctgctactctttct
ggtattgtagaaatgtatcatgagagaaaaagaagaggagaaattgacggaccagaagat
cctacattcataatggttactggtgacggtggtcatgatataggtatgggaccttctatt
ggtgctgctattagaaatcacaaaatgattatcttagaatatgataatgaaggatacatg
aacactggtaaccaattatcattctctactccattaggacatagaacttctacttctaac
gttggtaaagctgaagttggtaaacaattcggtcacaaagacgtagctcaaatatttaat
ggttgtcatataccttatattgctactggttgtgaagcttatcctttagatttagttaaa
aaagctgctaaagctcaatggtatgctaataacgttggtactgctttcgttaaacttctt
atcacttgtccattaaactggaaaactccagatgatatgggtaaagatattattaaagct
gctgttgattgttgtttcttcccattatatgaggttgaacaaggtatcactactatcact
aatatggtagctgatgacaaaaaacaacctgttactgaatggttaaaattaatgggtaaa
actaagcaccttcttaaacatcaagacatacttgataaattccaagcagatgttgataac
agatgggctcgcttaaaagctatgcatgaaagtcctgttctataa

DBGET integrated database retrieval system