KEGG   Brachyspira pilosicoli 95/1000: BP951000_0936Help
Entry
BP951000_0936     CDS       T01278                                 

Gene name
porG
Definition
pyruvate oxireductase
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
bpo  Brachyspira pilosicoli 95/1000
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bpo01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bpo00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bpo00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bpo00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bpo00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bpo00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:bpo00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:bpo00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1047060..1048028)
Genome map
AA seq 322 aa AA seqDB search
MGANSAGKMLAEVGVLTQGFYGAAFSSYGSEKKGSPVKSFVRFSETEVRVNSTVEEPHVV
AVFHMNLLKNPLTLAGVKEDAIVIFNTNKTPDEARDFAKLHGGKVVCIDAIKIANDLKLP
SQAANTIIMGAMVNQLDFIDSAKFEEQIRKQFGGRKAELVEPNIEAFRKGGSESVVKEFK
ADGKYPYIPYKKPEPVYGKNNQLTGGYINAAGNSTLKDLQVTRTGNIPVFNPANCIDCAN
CEVVCPDLCIVWEKGPDRKDPNKTAMNMMGIDYQYCKGCLKCVRACPKGPYSGKFEKDQQ
ALRIEVEANCDVDKLTYRRYKK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgggtgctaatagtgctggtaaaatgcttgcagaagtaggcgttttaacacaaggtttc
tatggtgctgcattctcaagttatggttcagaaaagaaaggttctccagtaaaatctttt
gtaaggttttcagaaactgaagttagagtaaactctactgtagaagaaccacatgtagtg
gcagtgttccacatgaatcttctaaaaaaccctcttacattagctggtgttaaagaagat
gctattgttatttttaacactaataaaacacctgatgaggcaagagattttgctaaatta
catggcggtaaagtagtttgtattgatgcaataaaaatcgctaatgatttaaaacttcct
tcacaagctgctaatactatcataatgggtgctatggttaatcagcttgatttcatagat
tctgctaagtttgaagagcaaatcagaaaacaattcggcggaagaaaagctgaattagtt
gagccaaatattgaagctttcagaaaaggcggaagtgaatctgttgttaaagaattcaaa
gctgacggaaaatatccttatattccttataaaaaaccagaacctgtatatggtaaaaat
aaccaattaacaggcggttatatcaatgctgctggtaactctactttaaaagatttacaa
gttactcgtactggtaatatacctgtattcaatcctgctaactgtattgattgtgctaac
tgtgaagttgtttgtcctgacctttgtatcgtttgggaaaaaggaccagacaggaaagac
cctaataaaactgctatgaatatgatgggtatagattatcaatactgtaaaggttgttta
aaatgtgttagagcttgccctaaaggaccttattctggtaaatttgaaaaagatcagcag
gctttaagaatagaagtagaagctaattgtgatgttgataaacttacatacagacgttat
aaaaaataa

DBGET integrated database retrieval system