KEGG   Brachyspira pilosicoli 95/1000: BP951000_0984Help
Entry
BP951000_0984     CDS       T01278                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bpo  Brachyspira pilosicoli 95/1000
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bpo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BP951000_0984
   01230 Biosynthesis of amino acids
    BP951000_0984
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BP951000_0984
  Energy metabolism
   00680 Methane metabolism
    BP951000_0984
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BP951000_0984
Enzymes [BR:bpo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BP951000_0984
Exosome [BR:bpo04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BP951000_0984
  Exosomal proteins of melanoma cells
   BP951000_0984
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1101343..1102089
Genome map
AA seq 248 aa AA seqDB search
MTKVVLIRHGESVWNKENLFTGWADVTLSEKGIEEAKSGGVELKKAGFTFDKAYTSTLTR
AIKTLNLVLEEMGLLWIPVEKCWQLNERHYGALQGLNKSQTAEKYGEDQVKIWRRSYDTP
PPALEKSDERYPGNDPRYKNLSEKELPLTECLKDTVARVVPFWENVILPDIKAGKKIIIA
AHGNSLRALVKYLDNISDADITELNIPTGMPLVYELDDNFKAVNKQYLGDPEAVKKAMEA
VANQGKKK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgactaaagttgttttaataagacatggtgagagtgtttggaataaagaaaaccttttt
actggttgggctgatgttactttatcagaaaaaggtattgaagaagctaaatctggcggt
gtagaacttaaaaaagctggttttacttttgataaagcttacacttctactcttactcgt
gcaatcaaaactttaaacttagtattggaagaaatgggacttttatggatacctgtagag
aaatgctggcaattaaatgaaagacattatggtgctttacagggattaaataaatctcaa
actgctgaaaaatatggtgaggaccaagtaaaaatatggagaagaagttatgatactccg
cctcctgctttagaaaaatctgatgaaagatatcctggaaatgaccctcgctataaaaac
ttatctgaaaaagaacttcctcttacagaatgtttaaaagacactgttgcaagagttgtt
cctttctgggaaaacgttatacttccagatattaaagctggtaaaaaaatcatcatcgct
gctcatggtaatagcttaagagcattagttaaatatttagataatatttctgatgcggat
attacagaacttaatatacctactggaatgcctttggtttacgagcttgatgataatttt
aaagctgttaataaacaatatttaggagaccctgaagctgttaaaaaagctatggaagct
gtagctaatcaaggtaagaaaaagtaa

DBGET integrated database retrieval system