KEGG   Brachyspira pilosicoli 95/1000: BP951000_1332Help
Entry
BP951000_1332     CDS       T01278                                 

Gene name
cheB
Definition
methyl-accepting chemotaxis proteins (MCP)-glutamate methylesterase, CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bpo  Brachyspira pilosicoli 95/1000
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:bpo02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:bpo02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1462126..1463262)
Genome map
AA seq 378 aa AA seqDB search
MGLFINILIAEDSKEISDNIKKILLKNPAVKIVNIVNNGIDAYKTIINKKIDFAFVEFNL
PMMSASELLKQLKKESINTKVIVLSTTDKNDDLNTRILNLGAFKIINKNAKIEYIENEIS
SIIINKNIKKEENIREIKIDESIKNNLFRNTTIQKNTINTFPHNISRVSDVIKKINYSDF
KNPKLIAIGISTGGPKALRSLIPSIPKNFPIPILIAQHIPKDFSSSLAKGLNDVSQITVK
EAEDNEEVKAGFAYICPGENNMGIYLDNDNIKIKLRPDLKLDLPYMPSVNHLFNTINDNL
KDQAIAVIMTGMGNDGTEGMINLYNNKNLTIAQNKTTSTIFGMPKSAIENNAVHFIISLY
DMAEFLVQYTTIKLKGLY
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgggattatttatcaatatattaatagcagaagattctaaggaaatatctgataatata
aaaaaaatacttttgaaaaatcctgctgtaaaaatagtaaatattgtaaataatggtata
gatgcatacaaaactataataaataaaaaaatagattttgcattcgtagaatttaacctg
ccaatgatgagtgcttctgaactccttaagcaattaaaaaaagagagcattaataccaaa
gtaatagtattatcaactacagataaaaatgatgatttgaatactagaatacttaatttg
ggagcatttaagattataaataagaatgctaaaatagaatatatagaaaatgaaatatca
agtattataataaataaaaatattaaaaaagaagaaaatataagagaaataaaaatagat
gaaagtataaaaaataatttatttagaaatactacaatacaaaaaaacacaataaacact
tttccgcacaatataagcagagtaagtgatgtaataaaaaaaataaactattctgatttt
aaaaatccaaaacttatagcaataggaatatccacaggaggtcctaaagcattaaggagt
ttaattccatctataccaaaaaacttcccaattccaatactaatagcacagcatatacca
aaagatttttcatcttctctagcaaaaggcttaaatgatgtatcacaaattacagttaaa
gaagcagaagataatgaggaagtaaaagcaggctttgcatatatttgcccaggtgaaaat
aatatgggtatatatttagataatgataatataaaaataaaattaagaccagatttgaaa
ctagacttgccatatatgccgtcagttaatcatttatttaatacaattaacgataaccta
aaagaccaagcaatagcagtaataatgacaggtatgggcaatgacggtactgaaggaatg
attaatttatacaacaataaaaatctcacaatagcacaaaataaaactacaagtactata
ttcggcatgcctaaaagtgctatagaaaacaatgctgttcattttataatatcgctttat
gatatggcagagtttttagtgcaatatacaacaataaaattaaaaggactatattaa

DBGET integrated database retrieval system