KEGG   Brachyspira pilosicoli 95/1000: BP951000_1414Help
Entry
BP951000_1414     CDS       T01278                                 

Gene name
ipk
Definition
putative 4-diphosphocytidyl-2-C-methyl-d-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bpo  Brachyspira pilosicoli 95/1000
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BP951000_1414 (ipk)
Enzymes [BR:bpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     BP951000_1414 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1543159..1544016)
Genome map
AA seq 285 aa AA seqDB search
MTELKSPCKVNLFLDITSKREDGYHLIESLFHTVDLYDIIEIKESNSFKITTSGKYKLND
NNEDNILSRIFFFFKDNMNLKKSYKINIEKNIPNGAGLGGGSSNAGLFIKFILKELEIKE
NEQLIKSFSKFGADIPFFIKRGMSWVNGIGENIFHYNYILPYKIIIIYPNIHVSTKVAYS
NFKTEDFNKADFLSFKSIFDNKELDFNNIYNNLYNVFENNVFSLEPKIKEYKEQIENKIN
KKIVMSGSGSSLFTLYDNDDKKIENDYNILKEEFPHLDVFKLALI
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgactgaattaaaatctccttgcaaagtaaacttatttttggatatcacatcaaaaaga
gaagacggatatcatttaatagaatctttatttcacactgttgatctttatgatattata
gaaataaaagaatcaaactctttcaaaattacaacctctggaaaatataaactaaatgat
aataatgaagataatatactttcaagaatatttttcttttttaaagataatatgaatcta
aaaaaaagttataaaataaatatagaaaaaaacataccaaacggtgctggtcttggagga
ggttcttctaatgccggactatttattaagtttatattaaaagaacttgaaataaaagaa
aatgaacagctaataaaatctttttctaagtttggagcagatattccattttttattaaa
agaggtatgagttgggttaatggcataggtgaaaatatttttcattataactacatactt
ccatataaaataataataatatacccaaatatacatgtatctacaaaagttgcttattca
aattttaaaacagaagattttaacaaagcagactttttatcttttaaatctatatttgat
aataaagaattagattttaataatatttataataatttatataatgtttttgaaaacaat
gtatttagtcttgagccaaaaataaaagaatataaagaacaaatagaaaataaaataaat
aaaaaaatagtgatgagcggttccggttcttctttatttactctgtatgataatgatgat
aaaaaaatagaaaatgattacaacatattaaaagaagaatttcctcatttagatgtattt
aaattagcattaatatag

DBGET integrated database retrieval system