KEGG   Brachyspira pilosicoli 95/1000: BP951000_1427Help
Entry
BP951000_1427     CDS       T01278                                 

Definition
family 1 glycoside hydrolase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
bpo  Brachyspira pilosicoli 95/1000
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:bpo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BP951000_1427
Enzymes [BR:bpo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     BP951000_1427
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1556633..1558057)
Genome map
AA seq 474 aa AA seqDB search
MPFKEGFLWGGATAANQCEGGFNKGGRGLANVDVAPHGKDRVAVIKGKMKMFDFDNEHFY
PSKDAIEMYTHYKEDIKLFAEMGFKVYRMSIAWSRIFPKGDEEKPNEEGLKFYEDVFKEC
LKYNIKPLVTITHFDCPMHLITKYGGWKNRIMIKFYENLCNVIFNRYKGLVEYWLTFNEI
NMILHAPFMGAGLYFEEGENEEEMKYQASHHELVASAIATKIAHEVDPNNKVGCMLAAGI
YYPYSSKPEDVLAAQHKNDEMYFFVDVQSRGKYPNYALKKFERENLNIKMEKEDLDILAK
YTVDFISFSYYSTRCATADKSKYTITKDNLEGDIKNPELKQTDWGWTVDPLGIRITLNDI
YDRYQKPMFIVENGLGAYDKPDENGYVEDDYRIEYLREHIKNMKDAVEIDGVDLIGYTTW
GPIDLVSAGTGEMSKRYGFIYVDRDDFGNGTLKRSKKKSFYWYKQVIDSNGENL
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgccatttaaagaaggttttttatggggcggagctaccgcagcaaatcaatgcgaaggc
ggatttaataaaggcggaagaggtttagctaatgtagatgttgctccgcatggtaaagat
agagttgctgttattaaaggaaaaatgaaaatgtttgattttgataatgaacatttttat
ccttcaaaagacgctatagaaatgtatactcattataaagaagatataaagctttttgct
gagatgggttttaaagtttacagaatgtctattgcttggagcagaatatttcctaaaggc
gatgaagaaaagcctaatgaagaaggcttaaaattttatgaagatgtatttaaagagtgc
ttaaaatataatataaaacctttagtaactatcacacattttgactgccctatgcattta
attacaaaatacggcggttggaaaaatagaataatgataaaattttatgagaatctttgt
aatgttatatttaatagatacaaaggtttagttgaatattggcttactttcaatgaaata
aatatgattttgcatgcaccttttatgggagctggactttattttgaagaaggcgaaaac
gaagaagaaatgaaatatcaggcaagccatcatgaattagttgctagtgcaatagctact
aaaatagctcatgaagtagaccctaataataaagttgggtgtatgttggctgcaggaatt
tattatccttactcttcaaaacctgaagatgtattggcagcacagcataaaaatgatgag
atgtatttctttgttgatgtacagtcaagaggaaaatatcctaattatgctttaaaaaag
tttgaaagagaaaacttaaacataaaaatggaaaaagaagatttagatatattagctaaa
tatactgttgattttatttctttctcttattattcaacaagatgtgctactgctgataag
agtaaatatacaataacaaaagataatttggaaggcgatataaaaaatcctgaattaaaa
caaactgattggggttggactgttgatccgcttggtataagaataactttaaatgacatt
tatgatagataccaaaaacctatgtttatagtagaaaatggacttggtgcttatgataag
cctgatgaaaatggttatgtagaagatgattatagaatagagtatttgagagaacatata
aaaaatatgaaagatgctgttgaaattgatggggttgatttgataggatatactacttgg
ggacctatagatttggtttctgctggtaccggtgaaatgtctaagagatatggttttata
tatgtagatagagatgattttggaaatggaactctaaaaagaagcaagaaaaaatcattc
tactggtataaacaagttatagatagtaatggggaaaatttataa

DBGET integrated database retrieval system