KEGG   Brachyspira pilosicoli 95/1000: BP951000_1671Help
Entry
BP951000_1671     CDS       T01278                                 

Definition
aldehyde alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
bpo  Brachyspira pilosicoli 95/1000
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bpo00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BP951000_1671
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BP951000_1671
   00620 Pyruvate metabolism
    BP951000_1671
   00650 Butanoate metabolism
    BP951000_1671
  Lipid metabolism
   00071 Fatty acid degradation
    BP951000_1671
  Amino acid metabolism
   00350 Tyrosine metabolism
    BP951000_1671
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BP951000_1671
   00626 Naphthalene degradation
    BP951000_1671
Enzymes [BR:bpo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BP951000_1671
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BP951000_1671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1824737..1827340
Genome map
AA seq 867 aa AA seqDB search
MTKDTKAKSGNSVLDDLISKAKKAQEIYSTFSQEQVDAIFKACAIAINSRRIPLAKMAVE
ETGMGVVEDKVIKNHFASEYIYNKFKDMKTCGIISEDTAMGMKKIAEPVGIIAGVVPTTN
PTSTAAFKALIALKTRNAIVFSPHPRAKKCTLEVCNIINKVAVEHGAPDGLVGCIEEPTV
ELSAALMSHPQIDLILATGGPGMVKAAYSSGKPALGVGAGNTPAIIDETADIKMAVNSVI
MSKTFDNGMICASEQTVVVVKSVYEEVKKEFLYRGAYLLNKDEKAKLSKVMIIDGALNAK
IVGQPAYVIAKMAGITVPEETKILIGEASSISKDEAFSYEKLSPVLGMYKADNYDDAVEK
AHSLIVFGGLGHTSVLYTDEDNQKERIKKFYEKMPTGRILINMPSSQGAIGDVYNFRLEP
SLTLGCGSWGNNSTSENVGPKHLLNIKSVASRRENMLWYRVPEKIYLKRGSLDVALREYA
NKKRALIITDGPLFKLGVTDNVTKVLDDIGVKYTIFSDVKPDPTISTVRDIVKTANVFEP
DVIIALGGGSPIDAGKIAWLLYENPEVKFEDIAMVFMDIRKRICDAGELGKKAQFVAIPT
TSGTGSETTPFAVITDDATHIKYPITDYALTPDMAILDANLVMSMPKGLCAASGIDSLTH
ALEAYASICSTEFSNSNAEKAIKLIFKYLPASYKEGAENPVAREQMHYAASLAGMAFANA
FLGICHSLAHKLGAAFNIPHGIANALLICQVVKYNSNEKPTKQGLFPQYKYPHARERYAF
IADMLGLGGKNDNEKVANLIKAINGLKKDLDIPLSIKDYGVAEKDFMAKLDDIVEQAFND
QCTGANPVYPLMKELKQIYLDAYNGVY
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atgactaaagatacaaaagcaaaaagcggaaattctgtactagatgacttaatatcaaaa
gcgaaaaaagcacaagaaatatattctactttttctcaagaacaagtagatgccatattt
aaagcatgtgctattgctattaacagcagaagaatacctttagcaaagatggctgtagaa
gaaacaggtatgggagtagtagaagataaagtaataaaaaatcactttgcttctgaatat
atttataacaagtttaaagatatgaagacatgcggaatcataagtgaagatactgctatg
ggaatgaaaaaaatagcagaacctgttggtataatagctggtgttgtacctactacaaac
ccaacatcaactgctgcattcaaagcattaatagctttaaaaacaagaaatgcaatagta
ttttctccgcatccaagagctaagaaatgtactcttgaagtttgtaatattattaacaaa
gtagctgttgagcatggggcacctgatggacttgttggctgtattgaagagcctacagtt
gagctttctgctgctttaatgagccatcctcaaattgatttaatacttgctactggagga
cctggaatggttaaggctgcttattctagcggtaaacctgctttaggtgttggtgctggt
aatactcctgctataatagatgaaactgctgatataaaaatggctgttaattctgttata
atgagtaaaacttttgacaatggtatgatatgtgctagtgaacagactgttgttgttgta
aaaagtgtttatgaggaagtaaaaaaagaattcctatacagaggagcttatcttttaaat
aaagatgaaaaagctaaacttagcaaagtaatgattatagacggtgctttgaatgctaag
atagtaggtcagcctgcttatgtgatagctaaaatggctggaattactgttccagaagag
acaaaaatacttataggtgaagcttcttctataagcaaagatgaagcattctcttacgaa
aaattatcacctgtacttggtatgtataaggctgataattatgatgatgctgttgagaaa
gctcatagtttaatagtatttggaggacttggacacacttctgtactttatacagatgaa
gataatcaaaaagaaagaattaaaaaattctacgaaaaaatgcctacaggaagaatactt
ataaatatgccgtcttctcaaggtgctataggagatgtatataactttagattagaacca
tctttgacattaggctgcggaagctggggtaacaactctacaagtgaaaacgttggtcct
aaacatcttttaaatattaaatctgtagcttcaaggagagaaaatatgttatggtataga
gtaccagaaaagatatatttaaaaagaggttcattagatgttgctttaagagaatatgct
aacaaaaaaagagcattaatcatcacagacggaccgcttttcaaattaggtgtaactgac
aatgttactaaagtattagatgatataggagtaaaatatactatattctctgatgttaag
ccagaccctacaattagtactgttagagatatagtaaaaacggctaatgtatttgaacct
gatgttattatagcattaggaggcggttctccaatagatgctggtaagattgcttggctt
ctttatgaaaaccctgaagtaaaattcgaagacattgctatggtatttatggatataaga
aagagaatatgtgatgctggtgaattaggtaaaaaggctcagtttgttgctatacctact
acttctggtactggttctgaaactactccttttgctgttattactgatgatgctacacat
attaaatatcctattacagattatgctttaactcctgatatggctatacttgatgctaat
ttggttatgagcatgccaaaaggtttatgtgctgcaagcggtatagactctttaactcat
gctcttgaggcttatgcttctatatgttctactgagttttctaattctaatgctgaaaaa
gctattaaattaatatttaaatatttgcctgcttcatataaagaaggtgctgaaaaccct
gtagctcgtgaacaaatgcattatgctgcttcacttgctggtatggcttttgctaatgct
ttcttgggtatttgtcactcattggctcataaacttggtgctgctttcaatattcctcat
ggtattgctaatgctcttttaatatgtcaggttgttaaatataactctaatgaaaaacct
actaaacaaggtttattccctcaatataaatatcctcatgctagagagagatatgcattt
attgctgatatgcttggtcttggcggcaaaaatgataatgaaaaagtagctaatttaatt
aaggctatcaatggtcttaagaaagatttggatatacctttgtctatcaaagattatggt
gtagctgaaaaagactttatggctaaacttgatgatatagtagaacaggcatttaatgat
caatgtactggtgctaatccggtttatcctcttatgaaagaattaaaacaaatttattta
gatgcttataatggtgtttattaa

DBGET integrated database retrieval system