KEGG   Brachyspira pilosicoli 95/1000: BP951000_1744Help
Entry
BP951000_1744     CDS       T01278                                 

Gene name
glcK
Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bpo  Brachyspira pilosicoli 95/1000
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bpo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BP951000_1744 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BP951000_1744 (glcK)
   00052 Galactose metabolism
    BP951000_1744 (glcK)
   00500 Starch and sucrose metabolism
    BP951000_1744 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    BP951000_1744 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BP951000_1744 (glcK)
   00524 Butirosin and neomycin biosynthesis
    BP951000_1744 (glcK)
Enzymes [BR:bpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BP951000_1744 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1902754..1903707
Genome map
AA seq 317 aa AA seqDB search
MKDAVIALDIGGTSIKGAIINEEGNILYKDSFNIEANFTSEEHKTNIANIIKKLLENMPS
EYNAIGIGLDCPGVMNSETLHMGGAENVPGLHGIKFSDIGDLFDLPIKTANDASMAALGE
AKYGSGKDKEYKSVMFITLGTGVGGGFVFNGKLFTGSLGGAGEVGHVFVVPDGDKCNCGS
SGCIERYASATGFIAMAKQKIHKNVVPTTLTYEELEKGKAKAIFDAAKKGDALAKETIAE
CSYYLGMSIAQALNMLDLDLVLIGGGLCKDFDMMIEHIKRGVNNYGLRMMVRNLEIKPAS
LGNDAGVLGCAAMFFRN
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgctgttattgctttagatataggaggcacttcaataaagggtgctataatt
aatgaagagggaaatattttatataaagatagctttaatatagaagctaattttacctct
gaagaacataagacaaatatagcaaatataataaaaaagcttttagagaatatgccttca
gaatataatgctataggaattggtttagattgtcctggagttatgaactctgagacgctt
catatgggaggagcagaaaatgttcctggtttgcatggcattaagttttctgatataggt
gatttatttgatttgcctatcaaaactgccaatgatgctagtatggctgcattaggtgag
gctaaatatggaagcggtaaggataaagaatataaatctgtaatgtttattacacttggc
actggtgtaggcggaggatttgtatttaacggcaaattatttacaggttctttgggagga
gctggtgaagtagggcatgtatttgtagttcccgatggtgataaatgtaattgcggttca
agcggctgtatagagcgttatgcttctgctactggttttattgctatggctaagcaaaag
attcataaaaatgttgttcctactactttaacttatgaggaattagaaaaaggtaaggct
aaggctatatttgatgctgctaaaaaaggagatgctcttgctaaagagactattgcggag
tgttcttattatttaggtatgtctatagcacaggctttgaatatgcttgatttggatttg
gttcttataggcggcgggctttgtaaagattttgatatgatgatagagcatattaaaaga
ggcgttaataattatggtcttagaatgatggtaagaaatcttgaaataaaacctgcttct
ttaggaaatgatgccggtgtattaggctgtgctgctatgttttttagaaattaa

DBGET integrated database retrieval system