KEGG   Brachyspira pilosicoli 95/1000: BP951000_1973Help
Entry
BP951000_1973     CDS       T01278                                 

Gene name
galM
Definition
aldose-1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
bpo  Brachyspira pilosicoli 95/1000
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bpo00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bpo00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2159731..2160729
Genome map
AA seq 332 aa AA seqDB search
MQVKNFNNGYLLYELKNKNDMVLKLTDIGASIVGVFVKDKNNNDVQVSFGSDDINFYLQP
HDYIGASVGRVANRTIDAEFTLDGVTYKLAKNDNNKHHLHGGVEGISFKKFDSKCINDKS
VLFSYFSKDGEEGYPGNVNINITYTLTDDNEIIIDYFANTDKKTPLNFTNHAYWNLNGDG
TIYEHELFIDSKYYLPVTDECVSTGEILKTENTPFDFTKNKKVGLDIEKCGGYDNCFIFA
NNDINKLKAKAYSEKTGISLEFYTTQPAMHFYSGNMLNNREVRNTVLNKHMAFCFESEYL
PGALNFLHFPSIIYSPDKDYKERTIYKLSLNK
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtaaaaaactttaacaatggctatttactttatgaattaaaaaataaaaatgat
atggtattaaaactcacagatattggagcttcaatagttggtgtgtttgtaaaggataaa
aataataatgatgttcaggtttcttttggaagcgatgatattaatttttatcttcaacct
catgattatataggtgcttctgttggtagagttgcaaatagaactatagatgcagagttt
acattagacggcgtaacatataaattagctaaaaatgataacaataaacatcatcttcat
ggtggtgttgagggtatatcatttaagaaatttgattctaaatgcattaatgataaaagc
gtattattttcttatttttcaaaagacggtgaagagggctacccaggaaacgtaaatatt
aatattacttatactcttacagatgataacgaaataataatagattattttgcaaataca
gataaaaaaactcctttgaactttactaatcatgcttattggaatctaaatggagacggc
actatatatgaacatgaattatttatagattcaaaatattatcttcctgtaacagatgaa
tgcgtatctactggagagattttaaaaacagagaacactccttttgactttacaaaaaat
aaaaaagtaggtctagatatagaaaaatgcggaggatatgataattgttttatatttgct
aataatgatataaacaaattaaaggccaaggcttatagtgaaaaaacgggtataagttta
gagttttacacaacacaacctgctatgcatttttattctggaaacatgcttaataataga
gaagtgagaaacactgtattaaataaacatatggctttttgttttgagagtgagtattta
cctggtgctttgaattttttacattttcctagtataatatattctcctgataaggattat
aaagagagaactatatataaattaagtttaaataaataa

DBGET integrated database retrieval system