KEGG   Brachyspira pilosicoli 95/1000: BP951000_1973Help
Entry
BP951000_1973     CDS       T01278                                 

Gene name
galM
Definition
(GenBank) aldose-1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
bpo  Brachyspira pilosicoli 95/1000
Pathway
bpo00010  Glycolysis / Gluconeogenesis
bpo00052  Galactose metabolism
bpo01100  Metabolic pathways
bpo01110  Biosynthesis of secondary metabolites
bpo01120  Microbial metabolism in diverse environments
bpo01130  Biosynthesis of antibiotics
Module
bpo_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:bpo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BP951000_1973 (galM)
   00052 Galactose metabolism
    BP951000_1973 (galM)
Enzymes [BR:bpo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     BP951000_1973 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ADK31951
UniProt: D8IFM8
Position
2159731..2160729
Genome map
AA seq 332 aa AA seqDB search
MQVKNFNNGYLLYELKNKNDMVLKLTDIGASIVGVFVKDKNNNDVQVSFGSDDINFYLQP
HDYIGASVGRVANRTIDAEFTLDGVTYKLAKNDNNKHHLHGGVEGISFKKFDSKCINDKS
VLFSYFSKDGEEGYPGNVNINITYTLTDDNEIIIDYFANTDKKTPLNFTNHAYWNLNGDG
TIYEHELFIDSKYYLPVTDECVSTGEILKTENTPFDFTKNKKVGLDIEKCGGYDNCFIFA
NNDINKLKAKAYSEKTGISLEFYTTQPAMHFYSGNMLNNREVRNTVLNKHMAFCFESEYL
PGALNFLHFPSIIYSPDKDYKERTIYKLSLNK
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtaaaaaactttaacaatggctatttactttatgaattaaaaaataaaaatgat
atggtattaaaactcacagatattggagcttcaatagttggtgtgtttgtaaaggataaa
aataataatgatgttcaggtttcttttggaagcgatgatattaatttttatcttcaacct
catgattatataggtgcttctgttggtagagttgcaaatagaactatagatgcagagttt
acattagacggcgtaacatataaattagctaaaaatgataacaataaacatcatcttcat
ggtggtgttgagggtatatcatttaagaaatttgattctaaatgcattaatgataaaagc
gtattattttcttatttttcaaaagacggtgaagagggctacccaggaaacgtaaatatt
aatattacttatactcttacagatgataacgaaataataatagattattttgcaaataca
gataaaaaaactcctttgaactttactaatcatgcttattggaatctaaatggagacggc
actatatatgaacatgaattatttatagattcaaaatattatcttcctgtaacagatgaa
tgcgtatctactggagagattttaaaaacagagaacactccttttgactttacaaaaaat
aaaaaagtaggtctagatatagaaaaatgcggaggatatgataattgttttatatttgct
aataatgatataaacaaattaaaggccaaggcttatagtgaaaaaacgggtataagttta
gagttttacacaacacaacctgctatgcatttttattctggaaacatgcttaataataga
gaagtgagaaacactgtattaaataaacatatggctttttgttttgagagtgagtattta
cctggtgctttgaattttttacattttcctagtataatatattctcctgataaggattat
aaagagagaactatatataaattaagtttaaataaataa

DBGET integrated database retrieval system