KEGG   Brachyspira pilosicoli 95/1000: BP951000_2066Help
Entry
BP951000_2066     CDS       T01278                                 

Gene name
bsaA
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bpo  Brachyspira pilosicoli 95/1000
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:bpo00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    BP951000_2066 (bsaA)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BP951000_2066 (bsaA)
Enzymes [BR:bpo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BP951000_2066 (bsaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2271508..2271861
Genome map
AA seq 117 aa AA seqDB search
MQDLYKKYKKDGFEILDFPCNQFGGQAKEPIEEIAEFRKEKYGVTFKLFDKVKVNSKNAD
PLFTYLRTEKPTEEGVDKIRWNFGKFLIDRQGNIVGRYDPRVKPEELDEIVSELLKK
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
ttgcaggatttatacaaaaaatataaaaaagatggttttgaaatattagactttccatgt
aatcaattcggcggacaggcaaaagagcctattgaagaaattgctgagtttagaaaagaa
aaatacggtgttacttttaagttatttgataaagtaaaagttaatagcaaaaatgctgac
cctttatttacttatttaagaaccgaaaaaccaactgaagagggtgttgataaaataaga
tggaattttggtaaatttttaatagataggcaaggcaatatagtagggcgttatgaccct
agggtaaaacctgaagaactcgatgagatagtatctgagttattaaaaaaataa

DBGET integrated database retrieval system