KEGG   Brachyspira pilosicoli 95/1000: BP951000_2163Help
Entry
BP951000_2163     CDS       T01278                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bpo  Brachyspira pilosicoli 95/1000
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BP951000_2163 (dxr)
Enzymes [BR:bpo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     BP951000_2163 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2374064..2375218)
Genome map
AA seq 384 aa AA seqDB search
MKKRVLILGATGSIGVNTCSVIEHFYNDFEIIGITTNTKIDVLKEECIKFKPKYVHISSK
EALDNFKNFNIDVNIHEGSIADFVKDIDFDILVNALVGYSGFLPTIEAIKKSKVVALANK
ETLVVGGDIINDLLKKHNAKLVPIDSEHSAIFQILNHFKNVPISKVIITASGGPFFRTPK
EELKNVTVEMALKHPTWNMGGKITIDSATMMNKGFEVIEAHHLFNLDYDKIETIIHPQSL
IHSMVEFVDGEIYAQIGKNDMRLPIQHALTYPEVRTTPFEKLKLYEHSDINFYKMDFDKF
IMLKLAYECGKKGGLYPCILNAANEVCVYSFLEKKISFTEIFDIVEKMVKINVDHIPLTV
ENIIKIDNETRKETLKLIETIKQM
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagagttctcatacttggtgccaccggttctataggagtaaacacttgctct
gtaatagaacatttttataatgactttgaaataataggaattactacaaatactaaaatt
gatgttttaaaagaagaatgcattaaattcaagccaaaatatgtgcatatatcttctaaa
gaagcattagataatttcaaaaattttaatatagatgttaatattcatgaaggaagcata
gctgattttgtaaaagatattgattttgatatactagtaaatgctttagtaggatattct
ggttttcttccaacaatagaagcaataaaaaaatctaaagttgtagcattagcaaataaa
gaaacattagttgtaggaggagatataattaatgatttattaaaaaaacataatgctaaa
ttagtaccaatagacagcgaacattctgcaatttttcaaatattaaatcattttaaaaat
gtaccaatatcaaaagtaataataacagcatcaggaggacctttctttagaactccaaaa
gaagagttaaaaaatgttacagtagaaatggcattaaaacacccaacttggaatatgggc
ggaaaaattacaatagacagtgccactatgatgaacaaaggttttgaagtaatagaagct
catcatttatttaatttggattatgacaaaatagaaactataatacaccctcaaagttta
atacattctatggttgagtttgtagacggagagatttatgctcaaattggaaagaatgat
atgcgtcttcctatacagcatgccctcacctacccagaagtaagaacaacaccatttgaa
aaattaaagctttatgaacatagcgatattaatttttataagatggattttgataagttt
attatgcttaaacttgcatatgaatgcggtaagaaaggcggactatatccttgtatatta
aatgctgctaatgaagtatgtgtgtattcatttttagagaaaaaaatatcatttactgaa
atatttgatatagtagaaaaaatggtaaaaataaatgttgatcacataccgcttactgta
gaaaatattataaaaatagacaatgaaactagaaaagaaactttaaaattaatagaaact
ataaaacaaatgtga

DBGET integrated database retrieval system