KEGG   Brachyspira pilosicoli 95/1000: BP951000_2221Help
Entry
BP951000_2221     CDS       T01278                                 

Gene name
dpm1
Definition
dolichyl-phosphate beta-D-mannosyltransferase
Orthology
K00721  
dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
bpo  Brachyspira pilosicoli 95/1000
Pathway
Metabolic pathways
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2443614..2444336)
Genome map
AA seq 240 aa AA seqDB search
MKAIIIIPTYNESDNIEKMLNTVLALPEYIEILVVDDNSPDGTASIVEKYLDNNRVHLLK
REKKEGLGPAYIAGFKHSFQYNPDYVIEMDADFSHDPNFVVNFVDRMEKENLDLVIGSRY
CNGISVVNWPLRRLFLSYYGNRYASFILGSKIMDITGGFKCFRVSVLKTMNFDNILSAGY
SFQIEMNYSFESNGKKIAEEPIIFYERRSGQSKMSKNIIAEALFRVVRLRFRDKSKYFNK
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctataataataatacctacttacaatgagagcgacaatatagagaaaatgctt
aataccgtattagcacttccagaatatatagaaatactagtagttgatgataatagtcca
gacggcacagcaagtattgttgagaaatatttagataataatagagttcatttattaaag
agagaaaaaaaagagggacttggacctgcttatatagctgggtttaaacattcttttcag
tataatcctgattatgttatagagatggatgcagatttttctcatgaccctaattttgtt
gttaattttgttgatagaatggaaaaagagaatttggatttagttataggttcaagatat
tgtaatggtattagtgtagttaattggcctttaagaagattatttttatcatactatgga
aatagatacgcttcatttatattaggttcaaagataatggatattactggcggatttaaa
tgctttagagtatctgtattaaaaactatgaactttgacaatattttatcagctggatat
tctttccagatagagatgaattattcttttgaaagcaatggtaaaaagatagcagaagag
cctattatattttatgaaagaagaagcggacaatccaaaatgtctaaaaacataatagct
gaagcattatttagagttgttcgtttaagatttagagataaatcaaaatattttaataaa
taa

DBGET integrated database retrieval system