KEGG   Brachyspira pilosicoli 95/1000: BP951000_2221Help
Entry
BP951000_2221     CDS       T01278                                 

Gene name
dpm1
Definition
(GenBank) dolichyl-phosphate beta-D-mannosyltransferase
  KO
K00721  dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
bpo  Brachyspira pilosicoli 95/1000
Pathway
bpo01100  Metabolic pathways
Brite
Enzymes [BR:bpo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.83  dolichyl-phosphate beta-D-mannosyltransferase
     BP951000_2221 (dpm1)
Glycosyltransferases [BR:bpo01003]
 N-Glycan biosynthesis
  Dol-P-Man biosyntheisis
   BP951000_2221 (dpm1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_tranf_2_4 Glyco_tranf_2_2 Glyco_transf_21
Motif
Other DBs
NCBI-ProteinID: ADK32194
UniProt: D8IA64
Position
complement(2443614..2444336)
Genome map
AA seq 240 aa AA seqDB search
MKAIIIIPTYNESDNIEKMLNTVLALPEYIEILVVDDNSPDGTASIVEKYLDNNRVHLLK
REKKEGLGPAYIAGFKHSFQYNPDYVIEMDADFSHDPNFVVNFVDRMEKENLDLVIGSRY
CNGISVVNWPLRRLFLSYYGNRYASFILGSKIMDITGGFKCFRVSVLKTMNFDNILSAGY
SFQIEMNYSFESNGKKIAEEPIIFYERRSGQSKMSKNIIAEALFRVVRLRFRDKSKYFNK
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctataataataatacctacttacaatgagagcgacaatatagagaaaatgctt
aataccgtattagcacttccagaatatatagaaatactagtagttgatgataatagtcca
gacggcacagcaagtattgttgagaaatatttagataataatagagttcatttattaaag
agagaaaaaaaagagggacttggacctgcttatatagctgggtttaaacattcttttcag
tataatcctgattatgttatagagatggatgcagatttttctcatgaccctaattttgtt
gttaattttgttgatagaatggaaaaagagaatttggatttagttataggttcaagatat
tgtaatggtattagtgtagttaattggcctttaagaagattatttttatcatactatgga
aatagatacgcttcatttatattaggttcaaagataatggatattactggcggatttaaa
tgctttagagtatctgtattaaaaactatgaactttgacaatattttatcagctggatat
tctttccagatagagatgaattattcttttgaaagcaatggtaaaaagatagcagaagag
cctattatattttatgaaagaagaagcggacaatccaaaatgtctaaaaacataatagct
gaagcattatttagagttgttcgtttaagatttagagataaatcaaaatattttaataaa
taa

DBGET integrated database retrieval system